Re: UniProt RDF as JSON-LD please test and give feedback,

• From: Jerven Tjalling Bolleman <jerven.bolleman@isb-sib.ch>
• Date: Thu, 20 Mar 2014 15:20:40 +0100
• To: public-linked-json@w3.org
• Message-ID: <532AF938.1040608@isb-sib.ch>

Second try, the jsonld was apparently a "executable file."
> Hi Markus, Nicholas,  Kingsley,
>
> Thanks for the great feedback.
>
> On 19/03/14 18:17, Markus Lanthaler wrote:
>> Hi Jerven,
>>
>> That's great news.
>>
>>
>>> This is now public, but not yet announced. One can see an example here
>>> http://www.uniprot.org/uniprot/P77967.jsonld and a simpler one
>>> http://www.uniprot.org/taxonomy/9606.jsonld
>>
>> Your context is at http://www.uniprot.org/contextjsonld (dot missing
>> before
>> "jsonld"?) and is served as text/html. You should serve it as
>> application/ld+json.
>>
> Fixed in master will be live in the announced release.
>> In general, I would suggest to avoid compact IRIs (rdfs:seeAlso) and use
>> simple terms (seeAlso) instead.
> As the JSON-LD is using our RDF writer I am worried this can cause
> collisions in the long run.
>> For things like rdfs:seeAlso you should also
>> set @type to @id in order to get rid of all the @id-objects.. you
>> would end
>> up with a simple array of strings.
> There are cases where these are not simple strings and then I would end
> up with something like this.
>
> rdfs:seeAlso": [
>      {
>        "@id": "http://www.ensembl.org/Homo_sapiens/Info/Index",
>        "up:reviewed": true
>      },
>      "https://www.msu.edu/~heslipst/contents/ANP440/sapiens.htm",
>      "http://en.wikipedia.org/wiki/Human_taxonomy",
> ]
>
> Which makes the JSON-LD more unpredictable which is IMHO more difficult
> for plain JSON developers.
>
>
>
>> On the other hand, you wouldn't need the
>> type-coercion of booleans if you would use real booleans in the data:
>>
>>    "up:reviewed": "true" --> "up:reviewed": true
> That is simpler, and will be in the released versions.
>>
>>
>>> It is very similar to our other RDF serializations, except for evidence
>>> tagging (provenance of an annotation). In the RDF/XML & Turtle this is
>>> done with reification and in JSON-LD with graphs.
>>
>> I would be interested in hearing why you made that decision.
> I thought that the graph based approach would give nicer JSON-LD now I
> am not so sure and going back to putting in quads so that the data is
> identical.
>
> I attached an example of the changes on a different entry.
> It won't play nice on the playground as the context uri does not exist.
>>
>>
>>> I would be very happy if you all could have a quick look at it and let
>>> me know if there are any bugs in it.
>>> Then I can put it in the news and have it announced for the next
>>> UniProt release as a public format.
>>
> Regards,
> Jerven Bolleman


{
"@context" : "http://www.uniprot.org/context.jsonld",
"@graph" : [ {
   "@id" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "@type" : "up:Protein",
   "up:reviewed" : false,
   "up:created" : "2002-06-01",
   "up:modified" : "2014-01-22",
   "up:version" : "88",
   "up:mnemonic" : "Q8QXN9_9ENTO",
   "up:citation" : [ {
     "@id" : "http://purl.uniprot.org/citations/17223130",
     "@type" : "up:Journal_Citation",
     "up:title" : "Stabilization of poliovirus polymerase by NTP binding 
and fingers-thumb interactions.",
     "up:author" : [ "Thompson A.A.", "Albertini R.A.", "Peersen O.B." ],
     "skos:exactMatch" : {
       "@id" : "http://purl.uniprot.org/pubmed/17223130"
     },
     "owl:sameAs" : {
       "@id" : "http://www.ncbi.nlm.nih.gov/pubmed/17223130"
     },
     "dcterms:identifier" : "doi:10.1016/j.jmb.2006.11.070",
     "up:date" : "2007",
     "up:name" : "J. Mol. Biol.",
     "up:volume" : "366",
     "up:pages" : "1459-1474"
   }, {
     "@id" : "http://purl.uniprot.org/citations/2555183",
     "@type" : "up:Journal_Citation",
     "up:title" : "Role of myristoylation of poliovirus capsid protein 
VP4 as determined by site-directed mutagenesis of its N-terminal sequence.",
     "up:author" : [ "van der Werf S.", "Marc D.", "Girard M.", "Drugeon 
G.", "Haenni A.L." ],
     "skos:exactMatch" : {
       "@id" : "http://purl.uniprot.org/pubmed/2555183"
     },
     "owl:sameAs" : {
       "@id" : "http://www.ncbi.nlm.nih.gov/pubmed/2555183"
     },
     "up:date" : "1989",
     "up:name" : "EMBO J.",
     "up:volume" : "8",
     "up:pages" : "2661-2668"
   }, {
     "@id" : "http://purl.uniprot.org/citations/11991962",
     "@type" : "up:Journal_Citation",
     "up:title" : "Characterization of CHAT and Cox type 1 
live-attenuated poliovirus vaccine strains.",
     "up:author" : [ "Minor P.D.", "Martin J." ],
     "skos:exactMatch" : {
       "@id" : "http://purl.uniprot.org/pubmed/11991962"
     },
     "owl:sameAs" : {
       "@id" : "http://www.ncbi.nlm.nih.gov/pubmed/11991962"
     },
     "dcterms:identifier" : "doi:10.1128/JVI.76.11.5339-5349.2002",
     "up:date" : "2002",
     "up:name" : "J. Virol.",
     "up:volume" : "76",
     "up:pages" : "5339-5349"
   }, {
     "@id" : "http://purl.uniprot.org/citations/17251299",
     "@type" : "up:Journal_Citation",
     "up:title" : "Crystal structure of poliovirus 3CD protein: virally 
encoded protease and precursor to the RNA-dependent RNA polymerase.",
     "up:author" : [ "Pathak H.B.", "Arnold J.J.", "Marcotte L.L.", 
"Hogle J.M.", "Filman D.J.", "Wass A.B.", "Gohara D.W.", "Cameron C.E." ],
     "skos:exactMatch" : {
       "@id" : "http://purl.uniprot.org/pubmed/17251299"
     },
     "owl:sameAs" : {
       "@id" : "http://www.ncbi.nlm.nih.gov/pubmed/17251299"
     },
     "dcterms:identifier" : "doi:10.1128/JVI.02306-06",
     "up:date" : "2007",
     "up:name" : "J. Virol.",
     "up:volume" : "81",
     "up:pages" : "3583-3596"
   } ],
   "rdfs:seeAlso" : [ {
     "@id" : "http://purl.uniprot.org/supfam/SSF52540",
     "@type" : "up:Resource",
     "up:database" : {
       "@id" : "http://purl.uniprot.org/database/SUPFAM"
     },
     "rdfs:comment" : "SSF52540"
   }, {
     "@id" : "http://purl.uniprot.org/interpro/IPR000605",
     "@type" : "up:Resource",
     "up:database" : {
       "@id" : "http://purl.uniprot.org/database/InterPro"
     },
     "rdfs:comment" : "Helicase_SF3_ssDNA/RNA_vir"
   }, {
     "@id" : "http://purl.uniprot.org/prosite/PS50507",
     "@type" : "up:Resource",
     "up:database" : {
       "@id" : "http://purl.uniprot.org/database/PROSITE"
     },
     "rdfs:comment" : "RDRP_SSRNA_POS"
   }, {
     "@id" : "http://purl.uniprot.org/embl-cds/CAD23059.1",
     "@type" : "up:Nucleotide_Resource",
     "up:database" : {
       "@id" : "http://purl.uniprot.org/database/EMBL"
     },
     "up:locatedOn" : {
       "@id" : "http://purl.uniprot.org/embl/AJ430385",
       "@type" : "up:Genomic_RNA"
     }
   }, {
     "@id" : "http://purl.uniprot.org/pdbsum/2IM2",
     "@type" : "up:Resource",
     "up:database" : {
       "@id" : "http://purl.uniprot.org/database/PDBsum"
     }
   }, {
     "@id" : "http://purl.uniprot.org/prosite/PS51218",
     "@type" : "up:Resource",
     "up:database" : {
       "@id" : "http://purl.uniprot.org/database/PROSITE"
     },
     "rdfs:comment" : "SF3_HELICASE_2"
   }, {
     "@id" : "http://purl.uniprot.org/interpro/IPR000199",
     "@type" : "up:Resource",
     "up:database" : {
       "@id" : "http://purl.uniprot.org/database/InterPro"
     },
     "rdfs:comment" : "Peptidase_C3A/C3B_picornavir"
   }, {
     "@id" : "http://purl.uniprot.org/pdbsum/2IM1",
     "@type" : "up:Resource",
     "up:database" : {
       "@id" : "http://purl.uniprot.org/database/PDBsum"
     }
   }, {
     "@id" : "http://purl.uniprot.org/proteinmodelportal/Q8QXN9",
     "@type" : "up:Resource",
     "up:database" : {
       "@id" : "http://purl.uniprot.org/database/ProteinModelPortal"
     }
   }, {
     "@id" : "http://purl.uniprot.org/supfam/SSF50494",
     "@type" : "up:Resource",
     "up:database" : {
       "@id" : "http://purl.uniprot.org/database/SUPFAM"
     },
     "rdfs:comment" : "SSF50494"
   }, {
     "@id" : "http://purl.uniprot.org/pdbsum/2IM0",
     "@type" : "up:Resource",
     "up:database" : {
       "@id" : "http://purl.uniprot.org/database/PDBsum"
     }
   }, {
     "@id" : "http://purl.uniprot.org/pfam/PF00947",
     "@type" : "up:Resource",
     "up:database" : {
       "@id" : "http://purl.uniprot.org/database/Pfam"
     },
     "rdfs:comment" : "Pico_P2A"
   }, {
     "@id" : "http://purl.uniprot.org/interpro/IPR001205",
     "@type" : "up:Resource",
     "up:database" : {
       "@id" : "http://purl.uniprot.org/database/InterPro"
     },
     "rdfs:comment" : "RNA-dir_pol_C"
   }, {
     "@id" : "http://purl.uniprot.org/pir/S09387",
     "@type" : "up:Resource",
     "up:database" : {
       "@id" : "http://purl.uniprot.org/database/PIR"
     }
   }, {
     "@id" : "http://purl.uniprot.org/interpro/IPR007094",
     "@type" : "up:Resource",
     "up:database" : {
       "@id" : "http://purl.uniprot.org/database/InterPro"
     },
     "rdfs:comment" : "RNA-dir_pol_PSvirus"
   }, {
     "@id" : "http://purl.uniprot.org/pfam/PF02226",
     "@type" : "up:Resource",
     "up:database" : {
       "@id" : "http://purl.uniprot.org/database/Pfam"
     },
     "rdfs:comment" : "Pico_P1A"
   }, {
     "@id" : "http://purl.uniprot.org/interpro/IPR014838",
     "@type" : "up:Resource",
     "up:database" : {
       "@id" : "http://purl.uniprot.org/database/InterPro"
     },
     "rdfs:comment" : "P3A"
   }, {
     "@id" : "http://purl.uniprot.org/pdbsum/2IJF",
     "@type" : "up:Resource",
     "up:database" : {
       "@id" : "http://purl.uniprot.org/database/PDBsum"
     }
   }, {
     "@id" : "http://purl.uniprot.org/pfam/PF00073",
     "@type" : "up:Resource",
     "up:database" : {
       "@id" : "http://purl.uniprot.org/database/Pfam"
     },
     "rdfs:comment" : "Rhv"
   }, {
     "@id" : "http://purl.uniprot.org/interpro/IPR009003",
     "@type" : "up:Resource",
     "up:database" : {
       "@id" : "http://purl.uniprot.org/database/InterPro"
     },
     "rdfs:comment" : "Trypsin-like_Pept_dom"
   }, {
     "@id" : "http://purl.uniprot.org/pdbsum/2ILZ",
     "@type" : "up:Resource",
     "up:database" : {
       "@id" : "http://purl.uniprot.org/database/PDBsum"
     }
   }, {
     "@id" : "http://purl.uniprot.org/interpro/IPR027417",
     "@type" : "up:Resource",
     "up:database" : {
       "@id" : "http://purl.uniprot.org/database/InterPro"
     },
     "rdfs:comment" : "P-loop_NTPase"
   }, {
     "@id" : "http://purl.uniprot.org/pfam/PF00680",
     "@type" : "up:Resource",
     "up:database" : {
       "@id" : "http://purl.uniprot.org/database/Pfam"
     },
     "rdfs:comment" : "RdRP_1"
   }, {
     "@id" : "http://purl.uniprot.org/interpro/IPR003138",
     "@type" : "up:Resource",
     "up:database" : {
       "@id" : "http://purl.uniprot.org/database/InterPro"
     },
     "rdfs:comment" : "Pico_P1A"
   }, {
     "@id" : "http://purl.uniprot.org/pfam/PF01552",
     "@type" : "up:Resource",
     "up:database" : {
       "@id" : "http://purl.uniprot.org/database/Pfam"
     },
     "rdfs:comment" : "Pico_P2B"
   }, {
     "@id" : "http://purl.uniprot.org/pdbsum/2ILY",
     "@type" : "up:Resource",
     "up:database" : {
       "@id" : "http://purl.uniprot.org/database/PDBsum"
     }
   }, {
     "@id" : "http://purl.uniprot.org/pdbsum/2IM3",
     "@type" : "up:Resource",
     "up:database" : {
       "@id" : "http://purl.uniprot.org/database/PDBsum"
     }
   }, {
     "@id" : "http://purl.uniprot.org/interpro/IPR001676",
     "@type" : "up:Resource",
     "up:database" : {
       "@id" : "http://purl.uniprot.org/database/InterPro"
     },
     "rdfs:comment" : "Picornavirus_capsid"
   }, {
     "@id" : "http://purl.uniprot.org/interpro/IPR014759",
     "@type" : "up:Resource",
     "up:database" : {
       "@id" : "http://purl.uniprot.org/database/InterPro"
     },
     "rdfs:comment" : "Helicase_SF3_ssRNA_vir"
   }, {
     "@id" : "http://purl.uniprot.org/pfam/PF08727",
     "@type" : "up:Resource",
     "up:database" : {
       "@id" : "http://purl.uniprot.org/database/Pfam"
     },
     "rdfs:comment" : "P3A"
   }, {
     "@id" : "http://purl.uniprot.org/prodom/PD649346",
     "@type" : "up:Resource",
     "up:database" : {
       "@id" : "http://purl.uniprot.org/database/ProDom"
     },
     "rdfs:comment" : "Pico_P2B"
   }, {
     "@id" : "http://rdf.wwpdb.org/pdb/2ILY",
     "@type" : "up:Structure_Resource",
     "up:database" : {
       "@id" : "http://purl.uniprot.org/database/PDB"
     },
     "up:method" : {
       "@id" : "http://purl.uniprot.org/core/X-Ray_Crystallography"
     },
     "up:resolution" : "2.60"
   }, {
     "@id" : "http://rdf.wwpdb.org/pdb/2ILZ",
     "@type" : "up:Structure_Resource",
     "up:database" : {
       "@id" : "http://purl.uniprot.org/database/PDB"
     },
     "up:method" : {
       "@id" : "http://purl.uniprot.org/core/X-Ray_Crystallography"
     },
     "up:resolution" : "2.50"
   }, {
     "@id" : "http://purl.uniprot.org/supfam/SSF89043",
     "@type" : "up:Resource",
     "up:database" : {
       "@id" : "http://purl.uniprot.org/database/SUPFAM"
     },
     "rdfs:comment" : "SSF89043"
   }, {
     "@id" : "http://purl.uniprot.org/interpro/IPR000081",
     "@type" : "up:Resource",
     "up:database" : {
       "@id" : "http://purl.uniprot.org/database/InterPro"
     },
     "rdfs:comment" : "Peptidase_C3"
   }, {
     "@id" : "http://purl.uniprot.org/smr/Q8QXN9",
     "@type" : "up:Resource",
     "up:database" : {
       "@id" : "http://purl.uniprot.org/database/SMR"
     },
     "rdfs:comment" : "2-579, 599-1030, 1457-1515, 1566-2209"
   }, {
     "@id" : "http://purl.uniprot.org/interpro/IPR002527",
     "@type" : "up:Resource",
     "up:database" : {
       "@id" : "http://purl.uniprot.org/database/InterPro"
     },
     "rdfs:comment" : "Pico_P2B"
   }, {
     "@id" : "http://rdf.wwpdb.org/pdb/2IM2",
     "@type" : "up:Structure_Resource",
     "up:database" : {
       "@id" : "http://purl.uniprot.org/database/PDB"
     },
     "up:method" : {
       "@id" : "http://purl.uniprot.org/core/X-Ray_Crystallography"
     },
     "up:resolution" : "2.35"
   }, {
     "@id" : "http://purl.uniprot.org/pfam/PF00910",
     "@type" : "up:Resource",
     "up:database" : {
       "@id" : "http://purl.uniprot.org/database/Pfam"
     },
     "rdfs:comment" : "RNA_helicase"
   }, {
     "@id" : "http://rdf.wwpdb.org/pdb/2IM3",
     "@type" : "up:Structure_Resource",
     "up:database" : {
       "@id" : "http://purl.uniprot.org/database/PDB"
     },
     "up:method" : {
       "@id" : "http://purl.uniprot.org/core/X-Ray_Crystallography"
     },
     "up:resolution" : "2.60"
   }, {
     "@id" : "http://rdf.wwpdb.org/pdb/2IJF",
     "@type" : "up:Structure_Resource",
     "up:database" : {
       "@id" : "http://purl.uniprot.org/database/PDB"
     },
     "up:method" : {
       "@id" : "http://purl.uniprot.org/core/X-Ray_Crystallography"
     },
     "up:resolution" : "3.00"
   }, {
     "@id" : "http://purl.uniprot.org/interpro/IPR003593",
     "@type" : "up:Resource",
     "up:database" : {
       "@id" : "http://purl.uniprot.org/database/InterPro"
     },
     "rdfs:comment" : "AAA+_ATPase"
   }, {
     "@id" : "http://purl.uniprot.org/smart/SM00382",
     "@type" : "up:Resource",
     "up:database" : {
       "@id" : "http://purl.uniprot.org/database/SMART"
     },
     "rdfs:comment" : "AAA"
   }, {
     "@id" : "http://rdf.wwpdb.org/pdb/2IM0",
     "@type" : "up:Structure_Resource",
     "up:database" : {
       "@id" : "http://purl.uniprot.org/database/PDB"
     },
     "up:method" : {
       "@id" : "http://purl.uniprot.org/core/X-Ray_Crystallography"
     },
     "up:resolution" : "2.25"
   }, {
     "@id" : "http://purl.uniprot.org/gene3d/4.10.80.10",
     "@type" : "up:Resource",
     "up:database" : {
       "@id" : "http://purl.uniprot.org/database/Gene3D"
     }
   }, {
     "@id" : "http://purl.uniprot.org/pfam/PF00548",
     "@type" : "up:Resource",
     "up:database" : {
       "@id" : "http://purl.uniprot.org/database/Pfam"
     },
     "rdfs:comment" : "Peptidase_C3"
   }, {
     "@id" : "http://rdf.wwpdb.org/pdb/2IM1",
     "@type" : "up:Structure_Resource",
     "up:database" : {
       "@id" : "http://purl.uniprot.org/database/PDB"
     },
     "up:method" : {
       "@id" : "http://purl.uniprot.org/core/X-Ray_Crystallography"
     },
     "up:resolution" : "2.50"
   }, {
     "@id" : "http://purl.uniprot.org/prodom/PD001306",
     "@type" : "up:Resource",
     "up:database" : {
       "@id" : "http://purl.uniprot.org/database/ProDom"
     },
     "rdfs:comment" : "Peptidase_C3"
   } ],
   "up:submittedName" : {
     "@id" : 
"sha:C2507C631F3F9C2E2C3B2245EEC4EFC6CA97E92BBDE92F4439365244FE7508833CADDDAC655DD0E038DF59E3E9BD7EF1",
     "@type" : "up:Structured_Name",
     "up:fullName" : "Polyprotein"
   },
   "up:organism" : {
     "@id" : "http://purl.uniprot.org/taxonomy/12080"
   },
   "up:annotation" : [ {
     "@id" : 
"sha:22978A1CE62271011D9DAEDC950CCBA6DE32B58E1A57F8BF035EF394AF7C3EF71D22DB6BE303E82AAA6E628C14E92B4A",
     "@type" : "up:Similarity_Annotation",
     "rdfs:comment" : "Contains SF3 helicase domain."
   }, {
     "@id" : 
"sha:406A21BE49122DC10BA7A8F17FCE4748F574767669575D4EDC5E2D961C6DF25A08272056B704617AC22014243100B1E0",
     "@type" : "up:NP_Binding_Annotation",
     "rdfs:comment" : "ATP",
     "up:range" : {
       "@id" : 
"http://purl.uniprot.org/range/22861395138591021tt1922tt1923",
       "@type" : "faldo:Region",
       "faldo:begin" : {
         "@id" : "http://purl.uniprot.org/position/22861395138591021tt1922",
         "@type" : "faldo:Position",
         "faldo:position" : "1922",
         "faldo:reference" : {
           "@id" : "http://purl.uniprot.org/isoforms/Q8QXN9-1"
         }
       },
       "faldo:end" : {
         "@id" : "http://purl.uniprot.org/position/22861395138591021tt1923",
         "@type" : "faldo:Position",
         "faldo:position" : "1923",
         "faldo:reference" : {
           "@id" : "http://purl.uniprot.org/isoforms/Q8QXN9-1"
         }
       }
     }
   }, {
     "@id" : 
"sha:B446A6108285C8C65F72D02282F79D1BBA827CB8FD6DDD7EC9B3D25D57AC4E0128F26B39AA562A79FDC463F8AD3AED15",
     "@type" : "up:Binding_Site_Annotation",
     "rdfs:comment" : "CTP",
     "up:range" : {
       "@id" : 
"http://purl.uniprot.org/range/22861395138591021tt2107tt2107",
       "@type" : "faldo:Region",
       "faldo:begin" : {
         "@id" : "http://purl.uniprot.org/position/22861395138591021tt2107",
         "@type" : "faldo:Position",
         "faldo:position" : "2107",
         "faldo:reference" : {
           "@id" : "http://purl.uniprot.org/isoforms/Q8QXN9-1"
         }
       },
       "faldo:end" : {
         "@id" : "http://purl.uniprot.org/position/22861395138591021tt2107"
       }
     }
   }, {
     "@id" : 
"sha:963335128AC4894E3B08D731E2D356B65A235B6E38682871FAE9EF6F3430762D523A40DFE22626226CA780821E75BEB6",
     "@type" : "up:Metal_Binding_Annotation",
     "rdfs:comment" : "Sodium 2",
     "up:range" : {
       "@id" : 
"http://purl.uniprot.org/range/22861395138591021tt2032tt2032",
       "@type" : "faldo:Region",
       "faldo:begin" : {
         "@id" : "http://purl.uniprot.org/position/22861395138591021tt2032",
         "@type" : "faldo:Position",
         "faldo:position" : "2032",
         "faldo:reference" : {
           "@id" : "http://purl.uniprot.org/isoforms/Q8QXN9-1"
         }
       },
       "faldo:end" : {
         "@id" : "http://purl.uniprot.org/position/22861395138591021tt2032"
       }
     }
   }, {
     "@id" : "http://purl.uniprot.org/annotation/PRO_5000068240",
     "@type" : "up:Chain_Annotation",
     "rdfs:comment" : "VP3 protein",
     "up:range" : {
       "@id" : "http://purl.uniprot.org/range/22861395138591021tt342tt579",
       "@type" : "faldo:Region",
       "faldo:begin" : {
         "@id" : "http://purl.uniprot.org/position/22861395138591021tt342",
         "@type" : "faldo:Position",
         "faldo:position" : "342",
         "faldo:reference" : {
           "@id" : "http://purl.uniprot.org/isoforms/Q8QXN9-1"
         }
       },
       "faldo:end" : {
         "@id" : "http://purl.uniprot.org/position/22861395138591021tt579",
         "@type" : "faldo:Position",
         "faldo:position" : "579",
         "faldo:reference" : {
           "@id" : "http://purl.uniprot.org/isoforms/Q8QXN9-1"
         }
       }
     }
   }, {
     "@id" : 
"sha:4621E5B0FB9C13CD7E6ABC6B73E7E506ACBE3CCE439B0D8FCEB36A49F5E8078FFE1543031471A684E233E8C2725AAE50",
     "@type" : "up:Metal_Binding_Annotation",
     "rdfs:comment" : "Sodium 2; via carbonyl oxygen",
     "up:range" : {
       "@id" : 
"http://purl.uniprot.org/range/22861395138591021tt2033tt2033",
       "@type" : "faldo:Region",
       "faldo:begin" : {
         "@id" : "http://purl.uniprot.org/position/22861395138591021tt2033",
         "@type" : "faldo:Position",
         "faldo:position" : "2033",
         "faldo:reference" : {
           "@id" : "http://purl.uniprot.org/isoforms/Q8QXN9-1"
         }
       },
       "faldo:end" : {
         "@id" : "http://purl.uniprot.org/position/22861395138591021tt2033"
       }
     }
   }, {
     "@id" : "http://purl.uniprot.org/annotation/PRO_5000068241",
     "@type" : "up:Chain_Annotation",
     "rdfs:comment" : "VP4 protein",
     "up:range" : {
       "@id" : "http://purl.uniprot.org/range/22861395138591021tt580tt881",
       "@type" : "faldo:Region",
       "faldo:begin" : {
         "@id" : "http://purl.uniprot.org/position/22861395138591021tt580",
         "@type" : "faldo:Position",
         "faldo:position" : "580",
         "faldo:reference" : {
           "@id" : "http://purl.uniprot.org/isoforms/Q8QXN9-1"
         }
       },
       "faldo:end" : {
         "@id" : "http://purl.uniprot.org/position/22861395138591021tt881",
         "@type" : "faldo:Position",
         "faldo:position" : "881",
         "faldo:reference" : {
           "@id" : "http://purl.uniprot.org/isoforms/Q8QXN9-1"
         }
       }
     }
   }, {
     "@id" : "http://purl.uniprot.org/annotation/PRO_5000068244",
     "@type" : "up:Chain_Annotation",
     "rdfs:comment" : "2C protein",
     "up:range" : {
       "@id" : 
"http://purl.uniprot.org/range/22861395138591021tt1128tt1456",
       "@type" : "faldo:Region",
       "faldo:begin" : {
         "@id" : "http://purl.uniprot.org/position/22861395138591021tt1128",
         "@type" : "faldo:Position",
         "faldo:position" : "1128",
         "faldo:reference" : {
           "@id" : "http://purl.uniprot.org/isoforms/Q8QXN9-1"
         }
       },
       "faldo:end" : {
         "@id" : "http://purl.uniprot.org/position/22861395138591021tt1456",
         "@type" : "faldo:Position",
         "faldo:position" : "1456",
         "faldo:reference" : {
           "@id" : "http://purl.uniprot.org/isoforms/Q8QXN9-1"
         }
       }
     }
   }, {
     "@id" : "http://purl.uniprot.org/annotation/PRO_5000068245",
     "@type" : "up:Chain_Annotation",
     "rdfs:comment" : "3A protein",
     "up:range" : {
       "@id" : 
"http://purl.uniprot.org/range/22861395138591021tt1457tt1543",
       "@type" : "faldo:Region",
       "faldo:begin" : {
         "@id" : "http://purl.uniprot.org/position/22861395138591021tt1457",
         "@type" : "faldo:Position",
         "faldo:position" : "1457",
         "faldo:reference" : {
           "@id" : "http://purl.uniprot.org/isoforms/Q8QXN9-1"
         }
       },
       "faldo:end" : {
         "@id" : "http://purl.uniprot.org/position/22861395138591021tt1543",
         "@type" : "faldo:Position",
         "faldo:position" : "1543",
         "faldo:reference" : {
           "@id" : "http://purl.uniprot.org/isoforms/Q8QXN9-1"
         }
       }
     }
   }, {
     "@id" : 
"sha:C7475BFCAEB87D05C8AC8417092D580AEDE2A32C64EE2E821E2B1C9C9CB2D8D36DDE566070D2A1AE907D839CAD06EFED",
     "@type" : "up:Binding_Site_Annotation",
     "rdfs:comment" : "ATP",
     "up:range" : {
       "@id" : "http://purl.uniprot.org/range/22861395138591021tt2107tt2107"
     }
   }, {
     "@id" : 
"sha:DE1F03A74D4F03E30E1676F3B8E209751765BBB275497C3ECD00EA8D41E4EF453EF008482DEC34A2C12630D1F5C149F6",
     "@type" : "up:Metal_Binding_Annotation",
     "rdfs:comment" : "Sodium 1; via carbonyl oxygen",
     "up:range" : {
       "@id" : 
"http://purl.uniprot.org/range/22861395138591021tt2098tt2098",
       "@type" : "faldo:Region",
       "faldo:begin" : {
         "@id" : "http://purl.uniprot.org/position/22861395138591021tt2098",
         "@type" : "faldo:Position",
         "faldo:position" : "2098",
         "faldo:reference" : {
           "@id" : "http://purl.uniprot.org/isoforms/Q8QXN9-1"
         }
       },
       "faldo:end" : {
         "@id" : "http://purl.uniprot.org/position/22861395138591021tt2098"
       }
     }
   }, {
     "@id" : "http://purl.uniprot.org/annotation/PRO_5000068242",
     "@type" : "up:Chain_Annotation",
     "rdfs:comment" : "2A protein",
     "up:range" : {
       "@id" : "http://purl.uniprot.org/range/22861395138591021tt882tt1030",
       "@type" : "faldo:Region",
       "faldo:begin" : {
         "@id" : "http://purl.uniprot.org/position/22861395138591021tt882",
         "@type" : "faldo:Position",
         "faldo:position" : "882",
         "faldo:reference" : {
           "@id" : "http://purl.uniprot.org/isoforms/Q8QXN9-1"
         }
       },
       "faldo:end" : {
         "@id" : "http://purl.uniprot.org/position/22861395138591021tt1030",
         "@type" : "faldo:Position",
         "faldo:position" : "1030",
         "faldo:reference" : {
           "@id" : "http://purl.uniprot.org/isoforms/Q8QXN9-1"
         }
       }
     }
   }, {
     "@id" : 
"sha:D0124137CDF5FC95FD835B0851D5CD5C6147F2EFB96F8F3A58C837C94345029C1ABE153EA7D02ACFD85DB55987D83041",
     "@type" : "up:NP_Binding_Annotation",
     "rdfs:comment" : "CTP",
     "up:range" : {
       "@id" : 
"http://purl.uniprot.org/range/22861395138591021tt1982tt1986",
       "@type" : "faldo:Region",
       "faldo:begin" : {
         "@id" : "http://purl.uniprot.org/position/22861395138591021tt1982",
         "@type" : "faldo:Position",
         "faldo:position" : "1982",
         "faldo:reference" : {
           "@id" : "http://purl.uniprot.org/isoforms/Q8QXN9-1"
         }
       },
       "faldo:end" : {
         "@id" : "http://purl.uniprot.org/position/22861395138591021tt1986",
         "@type" : "faldo:Position",
         "faldo:position" : "1986",
         "faldo:reference" : {
           "@id" : "http://purl.uniprot.org/isoforms/Q8QXN9-1"
         }
       }
     }
   }, {
     "@id" : "http://purl.uniprot.org/annotation/PRO_5000068243",
     "@type" : "up:Chain_Annotation",
     "rdfs:comment" : "2B protein",
     "up:range" : {
       "@id" : 
"http://purl.uniprot.org/range/22861395138591021tt1031tt1127",
       "@type" : "faldo:Region",
       "faldo:begin" : {
         "@id" : "http://purl.uniprot.org/position/22861395138591021tt1031",
         "@type" : "faldo:Position",
         "faldo:position" : "1031",
         "faldo:reference" : {
           "@id" : "http://purl.uniprot.org/isoforms/Q8QXN9-1"
         }
       },
       "faldo:end" : {
         "@id" : "http://purl.uniprot.org/position/22861395138591021tt1127",
         "@type" : "faldo:Position",
         "faldo:position" : "1127",
         "faldo:reference" : {
           "@id" : "http://purl.uniprot.org/isoforms/Q8QXN9-1"
         }
       }
     }
   }, {
     "@id" : 
"sha:C5CFF5641E51B4EBF0BE6CAB147DBC7AA5DBD989E279002553BE4BACCC286DD57ADC25093229D6A26FE0E3400D311661",
     "@type" : "up:Metal_Binding_Annotation",
     "rdfs:comment" : "Sodium 2; via carbonyl oxygen",
     "up:range" : {
       "@id" : 
"http://purl.uniprot.org/range/22861395138591021tt2017tt2017",
       "@type" : "faldo:Region",
       "faldo:begin" : {
         "@id" : "http://purl.uniprot.org/position/22861395138591021tt2017",
         "@type" : "faldo:Position",
         "faldo:position" : "2017",
         "faldo:reference" : {
           "@id" : "http://purl.uniprot.org/isoforms/Q8QXN9-1"
         }
       },
       "faldo:end" : {
         "@id" : "http://purl.uniprot.org/position/22861395138591021tt2017"
       }
     }
   }, {
     "@id" : "http://purl.uniprot.org/annotation/PRO_5000068238",
     "@type" : "up:Chain_Annotation",
     "rdfs:comment" : "VP1 protein",
     "up:range" : {
       "@id" : "http://purl.uniprot.org/range/22861395138591021tt2tt69",
       "@type" : "faldo:Region",
       "faldo:begin" : {
         "@id" : "http://purl.uniprot.org/position/22861395138591021tt2",
         "@type" : "faldo:Position",
         "faldo:position" : "2",
         "faldo:reference" : {
           "@id" : "http://purl.uniprot.org/isoforms/Q8QXN9-1"
         }
       },
       "faldo:end" : {
         "@id" : "http://purl.uniprot.org/position/22861395138591021tt69",
         "@type" : "faldo:Position",
         "faldo:position" : "69",
         "faldo:reference" : {
           "@id" : "http://purl.uniprot.org/isoforms/Q8QXN9-1"
         }
       }
     }
   }, {
     "@id" : 
"sha:C7D97F4D1BE0CA8FEA40647D5A35E968C77C51EB95E79B37F38B2E31159D13F55E4E460ADB7D7C12B73AABE607632937",
     "@type" : "up:NP_Binding_Annotation",
     "rdfs:comment" : "GTP",
     "up:range" : {
       "@id" : "http://purl.uniprot.org/range/22861395138591021tt1922tt1923"
     }
   }, {
     "@id" : 
"sha:51CB91E6A7D642C426B611C86208649C5C8AD97AA0CC0F70779D81D8AEF06B599FC79C92DF82B6B0A968E48D84574CBC",
     "@type" : "up:Metal_Binding_Annotation",
     "rdfs:comment" : "Sodium 1; via carbonyl oxygen",
     "up:range" : {
       "@id" : 
"http://purl.uniprot.org/range/22861395138591021tt1988tt1988",
       "@type" : "faldo:Region",
       "faldo:begin" : {
         "@id" : "http://purl.uniprot.org/position/22861395138591021tt1988",
         "@type" : "faldo:Position",
         "faldo:position" : "1988",
         "faldo:reference" : {
           "@id" : "http://purl.uniprot.org/isoforms/Q8QXN9-1"
         }
       },
       "faldo:end" : {
         "@id" : "http://purl.uniprot.org/position/22861395138591021tt1988"
       }
     }
   }, {
     "@id" : "http://purl.uniprot.org/annotation/PRO_5000068239",
     "@type" : "up:Chain_Annotation",
     "rdfs:comment" : "VP2 protein",
     "up:range" : {
       "@id" : "http://purl.uniprot.org/range/22861395138591021tt70tt341",
       "@type" : "faldo:Region",
       "faldo:begin" : {
         "@id" : "http://purl.uniprot.org/position/22861395138591021tt70",
         "@type" : "faldo:Position",
         "faldo:position" : "70",
         "faldo:reference" : {
           "@id" : "http://purl.uniprot.org/isoforms/Q8QXN9-1"
         }
       },
       "faldo:end" : {
         "@id" : "http://purl.uniprot.org/position/22861395138591021tt341",
         "@type" : "faldo:Position",
         "faldo:position" : "341",
         "faldo:reference" : {
           "@id" : "http://purl.uniprot.org/isoforms/Q8QXN9-1"
         }
       }
     }
   }, {
     "@id" : 
"sha:DD14D02ED584F99FD9C9DCA16D5E17B71EDC9DFCDDCDE8110EC711BFE430285E4A72817C5AF87109C86710801A5388BF",
     "@type" : "up:Binding_Site_Annotation",
     "rdfs:comment" : "ATP",
     "up:range" : {
       "@id" : 
"http://purl.uniprot.org/range/22861395138591021tt1915tt1915",
       "@type" : "faldo:Region",
       "faldo:begin" : {
         "@id" : "http://purl.uniprot.org/position/22861395138591021tt1915",
         "@type" : "faldo:Position",
         "faldo:position" : "1915",
         "faldo:reference" : {
           "@id" : "http://purl.uniprot.org/isoforms/Q8QXN9-1"
         }
       },
       "faldo:end" : {
         "@id" : "http://purl.uniprot.org/position/22861395138591021tt1915"
       }
     }
   }, {
     "@id" : 
"sha:E6E089BB7B738695CFD2344B5FD37F93DC27A4D7C9C347743F41DD185C2F0AF9B89B5AB0C1589F56655E71CB1CC15A77",
     "@type" : "up:Metal_Binding_Annotation",
     "rdfs:comment" : "Sodium 2; via carbonyl oxygen",
     "up:range" : {
       "@id" : 
"http://purl.uniprot.org/range/22861395138591021tt2016tt2016",
       "@type" : "faldo:Region",
       "faldo:begin" : {
         "@id" : "http://purl.uniprot.org/position/22861395138591021tt2016",
         "@type" : "faldo:Position",
         "faldo:position" : "2016",
         "faldo:reference" : {
           "@id" : "http://purl.uniprot.org/isoforms/Q8QXN9-1"
         }
       },
       "faldo:end" : {
         "@id" : "http://purl.uniprot.org/position/22861395138591021tt2016"
       }
     }
   }, {
     "@id" : 
"sha:EF0DF6382D46D140E6CC3CC7812772560F8672AE727CF81CF1AEC48D122CDF1F421ACA7A55B42F1DCC9099AA0AA5FB2B",
     "@type" : "up:Metal_Binding_Annotation",
     "rdfs:comment" : "Sodium 2",
     "up:range" : {
       "@id" : 
"http://purl.uniprot.org/range/22861395138591021tt2019tt2019",
       "@type" : "faldo:Region",
       "faldo:begin" : {
         "@id" : "http://purl.uniprot.org/position/22861395138591021tt2019",
         "@type" : "faldo:Position",
         "faldo:position" : "2019",
         "faldo:reference" : {
           "@id" : "http://purl.uniprot.org/isoforms/Q8QXN9-1"
         }
       },
       "faldo:end" : {
         "@id" : "http://purl.uniprot.org/position/22861395138591021tt2019"
       }
     }
   }, {
     "@id" : 
"sha:ED1A552EC576DB71D62330DD4294914C3C0C03D15C9F861B3B2F2DB98CF5D0E48D20B08E30F7C2615371B5730E2A4D8A",
     "@type" : "up:Catalytic_Activity_Annotation",
     "rdfs:comment" : "Nucleoside triphosphate + RNA(n) = diphosphate + 
RNA(n+1)."
   }, {
     "@id" : 
"sha:27D54F8B946A5C77E37F119158C5C6F6B678D232332CB9595ECAFBA2DDEC121986C20B75CDDD67F8B5246058CDA6B5BF",
     "@type" : "up:Catalytic_Activity_Annotation",
     "rdfs:comment" : "NTP + H(2)O = NDP + phosphate."
   }, {
     "@id" : 
"sha:D705F5D18AC04BE7B63EBF7397A172AFFAC9F0E6A5C42CE272CA4C2FDDD1B6CC391ACB5783E693EBE7F62FD658E566B9",
     "@type" : "up:Catalytic_Activity_Annotation",
     "rdfs:comment" : "Selective cleavage of Gln-|-Gly bond in the 
poliovirus polyprotein. In other picornavirus reactions Glu may be 
substituted for Gln, and Ser or Thr for Gly."
   }, {
     "@id" : 
"sha:CD1E7B697F6D791640EF9A7F9A035993553532689E8845B551A37F5BA3FC1F957A3AD638055CD3D8FE4C89EB624CDCD2",
     "@type" : "up:Subcellular_Location_Annotation",
     "up:locatedIn" : {
       "@id" : 
"sha:059A9B54AF2333F3F57498DC0938C88BB6E601D4569749E771BE37E28D78111E2DC9320B7AFCDD93047695D576AC43C7",
       "up:cellularComponent" : {
         "@id" : "http://purl.uniprot.org/locations/387"
       },
       "up:topology" : {
         "@id" : "http://purl.uniprot.org/locations/9903"
       },
       "up:orientation" : {
         "@id" : "http://purl.uniprot.org/locations/9910"
       }
     }
   }, {
     "@id" : 
"sha:282660931265EC96C28CE7E47418431C2D5DFC23DDF7E92CF75A4289FF6692B3873F007D1F1C5AE3522E61C90CF999EC",
     "@type" : "up:Binding_Site_Annotation",
     "rdfs:comment" : "GTP",
     "up:range" : {
       "@id" : "http://purl.uniprot.org/range/22861395138591021tt2107tt2107"
     }
   }, {
     "@id" : 
"sha:4D1DC3C2F95A29E4A2EBAD93DCEB3598789B7E8CC03DD46CF52175032E7A59E3FBB3D186117D231643AB19F56C117FFD",
     "@type" : "up:Similarity_Annotation",
     "rdfs:comment" : "Contains RdRp catalytic domain."
   }, {
     "@id" : 
"sha:C8E46D36D5FFF7DF4A42C090071503FD4C936A944B7E44912E909CA30339FC51B9B61F5295DA1A89B0830C3E01F448BD",
     "@type" : "up:NP_Binding_Annotation",
     "rdfs:comment" : "ATP",
     "up:range" : {
       "@id" : 
"http://purl.uniprot.org/range/22861395138591021tt1983tt1986",
       "@type" : "faldo:Region",
       "faldo:begin" : {
         "@id" : "http://purl.uniprot.org/position/22861395138591021tt1983",
         "@type" : "faldo:Position",
         "faldo:position" : "1983",
         "faldo:reference" : {
           "@id" : "http://purl.uniprot.org/isoforms/Q8QXN9-1"
         }
       },
       "faldo:end" : {
         "@id" : "http://purl.uniprot.org/position/22861395138591021tt1986"
       }
     }
   }, {
     "@id" : 
"sha:20DB84DF8ACB37740528D59BE80D073220E7F6EFA97BC6975E49ED5FF318D5BE87FB77C14784B38EF4DBA043BD5204EA",
     "@type" : "up:Binding_Site_Annotation",
     "rdfs:comment" : "CTP",
     "up:range" : {
       "@id" : 
"http://purl.uniprot.org/range/22861395138591021tt1911tt1911",
       "@type" : "faldo:Region",
       "faldo:begin" : {
         "@id" : "http://purl.uniprot.org/position/22861395138591021tt1911",
         "@type" : "faldo:Position",
         "faldo:position" : "1911",
         "faldo:reference" : {
           "@id" : "http://purl.uniprot.org/isoforms/Q8QXN9-1"
         }
       },
       "faldo:end" : {
         "@id" : "http://purl.uniprot.org/position/22861395138591021tt1911"
       }
     }
   }, {
     "@id" : 
"sha:D2C62626E4DD2CBF279BA52A7C34964B309583597829CC282EC0F06257CB011B1B987A55FC5F67D8A81C1F4C5C77DB89",
     "@type" : "up:Metal_Binding_Annotation",
     "rdfs:comment" : "Sodium 1",
     "up:range" : {
       "@id" : 
"http://purl.uniprot.org/range/22861395138591021tt1990tt1990",
       "@type" : "faldo:Region",
       "faldo:begin" : {
         "@id" : "http://purl.uniprot.org/position/22861395138591021tt1990",
         "@type" : "faldo:Position",
         "faldo:position" : "1990",
         "faldo:reference" : {
           "@id" : "http://purl.uniprot.org/isoforms/Q8QXN9-1"
         }
       },
       "faldo:end" : {
         "@id" : "http://purl.uniprot.org/position/22861395138591021tt1990"
       }
     }
   }, {
     "@id" : "http://purl.uniprot.org/annotation/PRO_5000068247",
     "@type" : "up:Chain_Annotation",
     "rdfs:comment" : "3C protein",
     "up:range" : {
       "@id" : 
"http://purl.uniprot.org/range/22861395138591021tt1566tt1748",
       "@type" : "faldo:Region",
       "faldo:begin" : {
         "@id" : "http://purl.uniprot.org/position/22861395138591021tt1566",
         "@type" : "faldo:Position",
         "faldo:position" : "1566",
         "faldo:reference" : {
           "@id" : "http://purl.uniprot.org/isoforms/Q8QXN9-1"
         }
       },
       "faldo:end" : {
         "@id" : "http://purl.uniprot.org/position/22861395138591021tt1748",
         "@type" : "faldo:Position",
         "faldo:position" : "1748",
         "faldo:reference" : {
           "@id" : "http://purl.uniprot.org/isoforms/Q8QXN9-1"
         }
       }
     }
   }, {
     "@id" : "http://purl.uniprot.org/annotation/PRO_5000068246",
     "@type" : "up:Chain_Annotation",
     "rdfs:comment" : "VPg protein",
     "up:range" : {
       "@id" : 
"http://purl.uniprot.org/range/22861395138591021tt1544tt1565",
       "@type" : "faldo:Region",
       "faldo:begin" : {
         "@id" : "http://purl.uniprot.org/position/22861395138591021tt1544",
         "@type" : "faldo:Position",
         "faldo:position" : "1544",
         "faldo:reference" : {
           "@id" : "http://purl.uniprot.org/isoforms/Q8QXN9-1"
         }
       },
       "faldo:end" : {
         "@id" : "http://purl.uniprot.org/position/22861395138591021tt1565",
         "@type" : "faldo:Position",
         "faldo:position" : "1565",
         "faldo:reference" : {
           "@id" : "http://purl.uniprot.org/isoforms/Q8QXN9-1"
         }
       }
     }
   }, {
     "@id" : "http://purl.uniprot.org/annotation/PRO_5000068248",
     "@type" : "up:Chain_Annotation",
     "rdfs:comment" : "3D protein",
     "up:range" : {
       "@id" : 
"http://purl.uniprot.org/range/22861395138591021tt1749tt2209",
       "@type" : "faldo:Region",
       "faldo:begin" : {
         "@id" : "http://purl.uniprot.org/position/22861395138591021tt1749",
         "@type" : "faldo:Position",
         "faldo:position" : "1749",
         "faldo:reference" : {
           "@id" : "http://purl.uniprot.org/isoforms/Q8QXN9-1"
         }
       },
       "faldo:end" : {
         "@id" : "http://purl.uniprot.org/position/22861395138591021tt2209",
         "@type" : "faldo:Position",
         "faldo:position" : "2209",
         "faldo:reference" : {
           "@id" : "http://purl.uniprot.org/isoforms/Q8QXN9-1"
         }
       }
     }
   }, {
     "@id" : 
"sha:FFCF50989CD8EB9C4EF17BA0EB2D6949C3CC629FBD09747924D7BC9A924931B436DC695EAC7FCA4E70536F964977C39A",
     "@type" : "up:Binding_Site_Annotation",
     "rdfs:comment" : "ATP",
     "up:range" : {
       "@id" : "http://purl.uniprot.org/range/22861395138591021tt1911tt1911"
     }
   }, {
     "@id" : 
"sha:7456B29DA999AB53E79ADA1849426F70FC4437C9ADF780E388BB7D780CCF84B552C6D20620A6390F7F806B5BE02E9F10",
     "@type" : "up:Similarity_Annotation",
     "rdfs:comment" : "Contains SFhelicase domain."
   }, {
     "@id" : 
"sha:A6EDCAD1A6CF7661B0FB797D75134C03941160AA53C5B9CDCF0DD1955ECB5675D04F75D2C929C9A0B51044B319A39DC5",
     "@type" : "up:NP_Binding_Annotation",
     "rdfs:comment" : "CTP",
     "up:range" : {
       "@id" : "http://purl.uniprot.org/range/22861395138591021tt1922tt1923"
     }
   }, {
     "@id" : 
"sha:51527B1C8771BD6E1D042B85016EE7CBA556DD806AB80DCD08A83FE13AB8F7695F17725B97CC29D11F871C5B7F4C6505",
     "@type" : "up:NP_Binding_Annotation",
     "rdfs:comment" : "GTP",
     "up:range" : {
       "@id" : "http://purl.uniprot.org/range/22861395138591021tt1982tt1986"
     }
   }, {
     "@id" : 
"sha:4950E69B2813DD130F757167FDB90CB61BD9C2CB964108A43407D8D6C407630A90A7F84D2D97177937E61AEC7495B832",
     "@type" : "up:Metal_Binding_Annotation",
     "rdfs:comment" : "Manganese",
     "up:range" : {
       "@id" : 
"http://purl.uniprot.org/range/22861395138591021tt2076tt2076",
       "@type" : "faldo:Region",
       "faldo:begin" : {
         "@id" : "http://purl.uniprot.org/position/22861395138591021tt2076",
         "@type" : "faldo:Position",
         "faldo:position" : "2076",
         "faldo:reference" : {
           "@id" : "http://purl.uniprot.org/isoforms/Q8QXN9-1"
         }
       },
       "faldo:end" : {
         "@id" : "http://purl.uniprot.org/position/22861395138591021tt2076"
       }
     }
   } ],
   "up:existence" : {
     "@id" : 
"http://purl.uniprot.org/core/Evidence_at_Protein_Level_Existence"
   },
   "up:classifiedWith" : [ {
     "@id" : "http://purl.uniprot.org/keywords/597"
   }, {
     "@id" : "http://purl.uniprot.org/go/0005198"
   }, {
     "@id" : "http://purl.uniprot.org/keywords/1035"
   }, {
     "@id" : "http://purl.uniprot.org/keywords/1036"
   }, {
     "@id" : "http://purl.uniprot.org/keywords/167"
   }, {
     "@id" : "http://purl.uniprot.org/keywords/479"
   }, {
     "@id" : "http://purl.uniprot.org/go/0004197"
   }, {
     "@id" : "http://purl.uniprot.org/go/0019079"
   }, {
     "@id" : "http://purl.uniprot.org/keywords/693"
   }, {
     "@id" : "http://purl.uniprot.org/keywords/694"
   }, {
     "@id" : "http://purl.uniprot.org/keywords/347"
   }, {
     "@id" : "http://purl.uniprot.org/keywords/342"
   }, {
     "@id" : "http://purl.uniprot.org/go/0016020"
   }, {
     "@id" : "http://purl.uniprot.org/keywords/696"
   }, {
     "@id" : "http://purl.uniprot.org/go/0019062"
   }, {
     "@id" : "http://purl.uniprot.org/go/0006351"
   }, {
     "@id" : "http://purl.uniprot.org/keywords/1043"
   }, {
     "@id" : "http://purl.uniprot.org/go/0018144"
   }, {
     "@id" : "http://purl.uniprot.org/go/0046718"
   }, {
     "@id" : "http://purl.uniprot.org/go/0006508"
   }, {
     "@id" : "http://purl.uniprot.org/keywords/788"
   }, {
     "@id" : "http://purl.uniprot.org/go/0005524"
   }, {
     "@id" : "http://purl.uniprot.org/go/0006811"
   }, {
     "@id" : "http://purl.uniprot.org/keywords/1161"
   }, {
     "@id" : "http://purl.uniprot.org/go/0001172"
   }, {
     "@id" : "http://purl.uniprot.org/keywords/1182"
   }, {
     "@id" : "http://purl.uniprot.org/go/0003724"
   }, {
     "@id" : "http://purl.uniprot.org/go/0003968"
   }, {
     "@id" : "http://purl.uniprot.org/keywords/464"
   }, {
     "@id" : "http://purl.uniprot.org/go/0003723"
   }, {
     "@id" : "http://purl.uniprot.org/go/0044162"
   }, {
     "@id" : "http://purl.uniprot.org/keywords/915"
   }, {
     "@id" : "http://purl.uniprot.org/keywords/2"
   }, {
     "@id" : "http://purl.uniprot.org/go/0019028"
   }, {
     "@id" : "http://purl.uniprot.org/go/0019048"
   } ],
   "up:sequence" : {
     "@id" : "http://purl.uniprot.org/isoforms/Q8QXN9-1",
     "@type" : "up:Simple_Sequence",
     "up:modified" : "2002-06-01",
     "up:version" : "1",
     "up:mass" : "246397",
     "up:crc64Checksum" : "AF9FB324CCDE991C",
     "rdf:value" : 
"MGAQVSSQKVGAHENSNRAYGGSTINYTTINYYRDSASNAASKQDFSQDPSKFTEPIKDALIKTAPMLNSPNIEACGYSDRVLQLTLGNSTITTQEAANSVVAYGRWPEYLRDSEANPVDQPTEPDVAACRFYTLDTVSWTKESRGWWWKLPDALRDMGLFGQNMYYHYLGRSGYTVHVQCNASKFHQGALGVFAVPEMCLAGDSNTTTMYTSYQNANPGEKGGTFTGTFTPDNNQTSPARRFCPVDYLFGNGTLLGNAFVFPHQIINLRTNNCATLVLPYVNSLSIDSMVKHNNWGIAILPLAPLNFASESSPEIPITLTMAPMCCEFNGLRNITLPRLQGLPVMNTPGSNQYLTADNFQSPCALPEFDVTPPIDIPGEVKNMMELAEIDTMIPFDLSATKKNTMEMYRVRLSDKPHTDDPILCLSLSPASDPRLSHTMLGEILNYYTHWAGSLKFTFLFCGSMMATGKLLVSYAPPGADPPKKRKEAMLGTHVIWDIGLQSSCTMVVPWISNTTYRQTIDDSFTEGGYISVFYQTRIVVPLSTPREMDILGFVSACNDFSVRLLRDTTHIEQKALAQGLGQMLESMIDNTVRETVGAATSRDALPNTEASGPVHSKEIPALTAVETGATNPLVPSDTVQTRHVVQHRSRSESSIESFFARGACVTIMTVDNSASTTNKGKLFAVWKITYKDTVQLRRKLEFFTYSRFDMEFTFVVTANFTETNNGHALNQVYQIMYVPPGAPVPEKWDDYTWQTSSNPSIFYTYGTAPARISVPYVGISNAYSHFYDGFSKVPLKDQSAALGDSLYGAASLNDFGILAVRVVNDHNPTKVTSKIRVYLKPKHIRVWCPRPPRAVAYYGPGVDYKDGTLAPLSTKDLTTYGFGHQNKAVYTAGYKICNYHLATQEDLQNAVNVMWNRDLLVTESRAQGTDSIARCNCNAGVYYCESRRKYYPVSFVGPTFQYMEANNYYPARYQSHMLIGHGFASPG!
 DCGGILRCHH
GVIGIITAGGEGLVAFSDIRDLYAYEEEAMEQGITNYIESLGAAFGSGFTQQIGDKITELTNMVTSTITEKLLKNLIKIISSLVIITRNYEDTTTVLATLALLGCDASPWQWLRKKACDVLEIPYVIKQGDSWLKKFTEACNAAKGLEWVSNKISKFIDWLKEKIIPQARDKLEFVTKLRQLEMLENQISTIHQSCPSQEHQEILFNNVRWLSIQSKRFAPLYAVEAKRIQKLEHTINNYIQFKSKHRIEPVCLLVHGSPGTGKSVATNLIARAIAERENTSTYSLPPDPSHFDGYKQQGVVIMDDLNQNPDGADMKLFCQMVSTVEFIPPMASLEEKGILFTSNYVLASTNSSRISPPTVAHSDALARRFAFDMDIQVMNEYSRDGKLNMAMATEMCKNCHQPANFKRCCPLVCGKAIQLMDKSSRVRYSIDQITTMVINERNRRSNIGNCMEALFQGPLQYKDLKIDIKTSPPPECINDLLQAVDSQEVRDYCEKKGWIVNITSQVQAERNINRAMTILQAVTTFAAVAGVVYVMYKLFAGHQGAYTGLPNKKPNVPTIRTAKVQGPGFDYAVAMAKRNIVTATTSKGEFTMLGVHDNVAILPTHASPGESIVIDGKEVEILDAKALEDQAGTNLEITIITLKRNEKFRDIRPHIPTQITETNDGVLIVNTSKYPNMYVPVGAVTEQGYLNLGGRQTARVLMYNFPTRAGQCGGVITCTGKVIGMHVGGNGSHGFAAALKRSYFTQSQGEIQWVRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMCLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGCDPDLFWSKIPVLMEEKLFAFDYTGYDA!
 SLSPAWFEAL
KMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYCVKGGMPSGCSGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALLLPEYSTLYRRWLDSF"
   },
   "up:attribution" : [ {
     "@id" : "_513851584E39009B",
     "rdfs:label" : "7",
     "up:evidence" : {
       "@id" : "http://purl.obolibrary.org/obo/ECO_0000203"
     },
     "up:source" : {
       "@id" : "http://purl.uniprot.org/saas/SAAS000199_004_000318"
     }
   }, {
     "@id" : "_513851584E3900A8",
     "rdfs:label" : "11",
     "up:evidence" : {
       "@id" : "http://purl.obolibrary.org/obo/ECO_0000203"
     },
     "up:source" : {
       "@id" : "http://purl.uniprot.org/saas/SAAS000199_004_000923"
     }
   }, {
     "@id" : "_513851584E3900C0",
     "dcterms:creator" : {
       "@id" : "http://purl.uniprot.org/goa-projects/UniProtKB-KW"
     },
     "up:evidence" : {
       "@id" : "http://purl.obolibrary.org/obo/ECO_0000203"
     }
   }, {
     "@id" : "_513851584E3900A3",
     "rdfs:label" : "9",
     "up:evidence" : {
       "@id" : "http://purl.obolibrary.org/obo/ECO_0000203"
     },
     "up:source" : {
       "@id" : "http://purl.uniprot.org/saas/SAAS000199_004_000827"
     }
   }, {
     "@id" : "_513851584E3900C2",
     "dcterms:creator" : {
       "@id" : "http://purl.uniprot.org/goa-projects/UniProtKB-KW"
     },
     "up:evidence" : {
       "@id" : "http://purl.obolibrary.org/obo/ECO_0000203"
     }
   }, {
     "@id" : "_513851584E3900C4",
     "dcterms:creator" : {
       "@id" : "http://purl.uniprot.org/goa-projects/UniProtKB-KW"
     },
     "up:evidence" : {
       "@id" : "http://purl.obolibrary.org/obo/ECO_0000203"
     }
   }, {
     "@id" : "_513851584E3900A6",
     "rdfs:label" : "15",
     "up:evidence" : {
       "@id" : "http://purl.obolibrary.org/obo/ECO_0000203"
     },
     "up:source" : {
       "@id" : "http://purl.uniprot.org/saas/SAAS000199_004_000370"
     }
   }, {
     "@id" : "_513851584E3900C6",
     "dcterms:creator" : {
       "@id" : "http://purl.uniprot.org/goa-projects/InterPro"
     },
     "up:evidence" : {
       "@id" : "http://purl.obolibrary.org/obo/ECO_0000203"
     }
   }, {
     "@id" : "_513851584E390099",
     "rdfs:label" : "12",
     "up:evidence" : {
       "@id" : "http://purl.obolibrary.org/obo/ECO_0000203"
     },
     "up:source" : {
       "@id" : "http://purl.uniprot.org/saas/SAAS000199_004_000745"
     }
   }, {
     "@id" : "_513851584E3900C8",
     "dcterms:creator" : {
       "@id" : "http://purl.uniprot.org/goa-projects/InterPro"
     },
     "up:evidence" : {
       "@id" : "http://purl.obolibrary.org/obo/ECO_0000203"
     }
   }, {
     "@id" : "_513851584E3900A1",
     "rdfs:label" : "4",
     "up:evidence" : {
       "@id" : "http://purl.obolibrary.org/obo/ECO_0000203"
     },
     "up:source" : {
       "@id" : "http://purl.uniprot.org/saas/SAAS000199_004_000236"
     }
   }, {
     "@id" : "_513851584E390097",
     "rdfs:label" : "5",
     "up:evidence" : {
       "@id" : "http://purl.obolibrary.org/obo/ECO_0000203"
     },
     "up:source" : {
       "@id" : "http://purl.uniprot.org/saas/SAAS000199_004_000393"
     }
   }, {
     "@id" : "_513851584E39003D",
     "rdfs:label" : "17",
     "up:evidence" : {
       "@id" : "http://purl.obolibrary.org/obo/ECO_0000203"
     },
     "up:source" : {
       "@id" : "http://purl.uniprot.org/saas/SAAS000199_004_001459"
     }
   }, {
     "@id" : "_513851584E390095",
     "rdfs:label" : "6",
     "up:evidence" : {
       "@id" : "http://purl.obolibrary.org/obo/ECO_0000203"
     },
     "up:source" : {
       "@id" : "http://purl.uniprot.org/saas/SAAS000199_004_000162"
     }
   }, {
     "@id" : "_513851584E39003A",
     "rdfs:label" : "3",
     "up:evidence" : {
       "@id" : "http://purl.obolibrary.org/obo/ECO_0000203"
     },
     "up:source" : {
       "@id" : "http://purl.uniprot.org/saas/SAAS000199_004_001627"
     }
   }, {
     "@id" : "_513851584E39002",
     "rdfs:label" : "19",
     "up:evidence" : {
       "@id" : "http://purl.obolibrary.org/obo/ECO_0000313"
     },
     "up:source" : {
       "@id" : "http://purl.uniprot.org/pir/S09387"
     }
   }, {
     "@id" : "_513851584E390092",
     "rdfs:label" : "8",
     "up:evidence" : {
       "@id" : "http://purl.obolibrary.org/obo/ECO_0000203"
     },
     "up:source" : {
       "@id" : "http://purl.uniprot.org/saas/SAAS000199_004_000356"
     }
   }, {
     "@id" : "_513851584E3900CA",
     "dcterms:creator" : {
       "@id" : "http://purl.uniprot.org/goa-projects/GOC"
     },
     "up:evidence" : {
       "@id" : "http://purl.obolibrary.org/obo/ECO_0000203"
     }
   }, {
     "@id" : "_513851584E3900AC",
     "rdfs:label" : "13",
     "up:evidence" : {
       "@id" : "http://purl.obolibrary.org/obo/ECO_0000203"
     },
     "up:source" : {
       "@id" : "http://purl.uniprot.org/saas/SAAS000199_004_000596"
     }
   }, {
     "@id" : "_513851584E3900CC",
     "dcterms:creator" : {
       "@id" : "http://purl.uniprot.org/goa-projects/UniProtKB-KW"
     },
     "up:evidence" : {
       "@id" : "http://purl.obolibrary.org/obo/ECO_0000203"
     }
   }, {
     "@id" : "_513851584E3900AE",
     "dcterms:creator" : {
       "@id" : "http://purl.uniprot.org/goa-projects/UniProtKB-SubCell"
     },
     "up:evidence" : {
       "@id" : "http://purl.obolibrary.org/obo/ECO_0000203"
     }
   }, {
     "@id" : "_513851584E3900CE",
     "dcterms:creator" : {
       "@id" : "http://purl.uniprot.org/goa-projects/UniProtKB-KW"
     },
     "up:evidence" : {
       "@id" : "http://purl.obolibrary.org/obo/ECO_0000203"
     }
   }, {
     "@id" : "_513851584E3900AA",
     "rdfs:label" : "14",
     "up:evidence" : {
       "@id" : "http://purl.obolibrary.org/obo/ECO_0000203"
     },
     "up:source" : {
       "@id" : "http://purl.uniprot.org/saas/SAAS000199_004_000426"
     }
   }, {
     "@id" : "_513851584E3900D",
     "rdfs:label" : "26",
     "up:evidence" : {
       "@id" : "http://purl.obolibrary.org/obo/ECO_0000313"
     },
     "up:source" : {
       "@id" : "http://rdf.wwpdb.org/pdb/2IM3"
     }
   }, {
     "@id" : "_513851584E3900C",
     "rdfs:label" : "25",
     "up:evidence" : {
       "@id" : "http://purl.obolibrary.org/obo/ECO_0000313"
     },
     "up:source" : {
       "@id" : "http://rdf.wwpdb.org/pdb/2IM2"
     }
   }, {
     "@id" : "_513851584E3900B",
     "rdfs:label" : "24",
     "up:evidence" : {
       "@id" : "http://purl.obolibrary.org/obo/ECO_0000313"
     },
     "up:source" : {
       "@id" : "http://rdf.wwpdb.org/pdb/2IM1"
     }
   }, {
     "@id" : "_513851584E3900A",
     "rdfs:label" : "23",
     "up:evidence" : {
       "@id" : "http://purl.obolibrary.org/obo/ECO_0000313"
     },
     "up:source" : {
       "@id" : "http://rdf.wwpdb.org/pdb/2IM0"
     }
   }, {
     "@id" : "_513851584E3900B2",
     "dcterms:creator" : {
       "@id" : "http://purl.uniprot.org/goa-projects/UniProtKB-KW"
     },
     "up:evidence" : {
       "@id" : "http://purl.obolibrary.org/obo/ECO_0000203"
     }
   }, {
     "@id" : "_513851584E3900D0",
     "dcterms:creator" : {
       "@id" : "http://purl.uniprot.org/goa-projects/InterPro"
     },
     "up:evidence" : {
       "@id" : "http://purl.obolibrary.org/obo/ECO_0000203"
     }
   }, {
     "@id" : "_513851584E39002D",
     "rdfs:label" : "1",
     "up:evidence" : {
       "@id" : "http://purl.obolibrary.org/obo/ECO_0000203"
     },
     "up:source" : {
       "@id" : "http://purl.uniprot.org/saas/SAAS000199_004_001795"
     }
   }, {
     "@id" : "_513851584E3900B0",
     "dcterms:creator" : {
       "@id" : "http://purl.uniprot.org/goa-projects/UniProtKB-KW"
     },
     "up:evidence" : {
       "@id" : "http://purl.obolibrary.org/obo/ECO_0000203"
     }
   }, {
     "@id" : "_513851584E3900B6",
     "dcterms:creator" : {
       "@id" : "http://purl.uniprot.org/goa-projects/InterPro"
     },
     "up:evidence" : {
       "@id" : "http://purl.obolibrary.org/obo/ECO_0000203"
     }
   }, {
     "@id" : "_513851584E3900B4",
     "dcterms:creator" : {
       "@id" : "http://purl.uniprot.org/goa-projects/UniProtKB-KW"
     },
     "up:evidence" : {
       "@id" : "http://purl.obolibrary.org/obo/ECO_0000203"
     }
   }, {
     "@id" : "_513851584E39009",
     "rdfs:label" : "22",
     "up:evidence" : {
       "@id" : "http://purl.obolibrary.org/obo/ECO_0000313"
     },
     "up:source" : {
       "@id" : "http://rdf.wwpdb.org/pdb/2ILY"
     }
   }, {
     "@id" : "_513851584E39008",
     "rdfs:label" : "21",
     "up:evidence" : {
       "@id" : "http://purl.obolibrary.org/obo/ECO_0000313"
     },
     "up:source" : {
       "@id" : "http://rdf.wwpdb.org/pdb/2ILZ"
     }
   }, {
     "@id" : "_513851584E39006",
     "rdfs:label" : "20",
     "up:evidence" : {
       "@id" : "http://purl.obolibrary.org/obo/ECO_0000313"
     },
     "up:source" : {
       "@id" : "http://purl.uniprot.org/embl-cds/CAD23059.1"
     }
   }, {
     "@id" : "_513851584E3900B8",
     "dcterms:creator" : {
       "@id" : "http://purl.uniprot.org/goa-projects/UniProtKB-KW"
     },
     "up:evidence" : {
       "@id" : "http://purl.obolibrary.org/obo/ECO_0000203"
     }
   }, {
     "@id" : "_513851584E39009F",
     "rdfs:label" : "10",
     "up:evidence" : {
       "@id" : "http://purl.obolibrary.org/obo/ECO_0000203"
     },
     "up:source" : {
       "@id" : "http://purl.uniprot.org/saas/SAAS000199_004_000411"
     }
   }, {
     "@id" : "_513851584E3900BC",
     "dcterms:creator" : {
       "@id" : "http://purl.uniprot.org/goa-projects/UniProtKB-KW"
     },
     "up:evidence" : {
       "@id" : "http://purl.obolibrary.org/obo/ECO_0000203"
     }
   }, {
     "@id" : "_513851584E390037",
     "rdfs:label" : "2",
     "up:evidence" : {
       "@id" : "http://purl.obolibrary.org/obo/ECO_0000203"
     },
     "up:source" : {
       "@id" : "http://purl.uniprot.org/saas/SAAS000199_004_000000"
     }
   }, {
     "@id" : "_513851584E3900BA",
     "dcterms:creator" : {
       "@id" : "http://purl.uniprot.org/goa-projects/InterPro"
     },
     "up:evidence" : {
       "@id" : "http://purl.obolibrary.org/obo/ECO_0000203"
     }
   }, {
     "@id" : "_513851584E390033",
     "rdfs:label" : "16",
     "up:evidence" : {
       "@id" : "http://purl.obolibrary.org/obo/ECO_0000203"
     },
     "up:source" : {
       "@id" : "http://purl.uniprot.org/saas/SAAS000199_004_017722"
     }
   }, {
     "@id" : "_513851584E3900BE",
     "dcterms:creator" : {
       "@id" : "http://purl.uniprot.org/goa-projects/InterPro"
     },
     "up:evidence" : {
       "@id" : "http://purl.obolibrary.org/obo/ECO_0000203"
     }
   }, {
     "@id" : "_513851584E3900F",
     "rdfs:label" : "27",
     "up:evidence" : {
       "@id" : "http://purl.obolibrary.org/obo/ECO_0000313"
     },
     "up:source" : {
       "@id" : "http://rdf.wwpdb.org/pdb/2IJF"
     }
   }, {
     "@id" : "_513851584E390030",
     "rdfs:label" : "18",
     "up:evidence" : {
       "@id" : "http://purl.obolibrary.org/obo/ECO_0000203"
     },
     "up:source" : {
       "@id" : "http://purl.uniprot.org/saas/SAAS000199_004_003962"
     }
   } ]
}, {
   "@id" : "_513851584E39001",
   "@type" : "up:Citation_Statement",
   "up:scope" : "NUCLEOTIDE SEQUENCE",
   "up:attribution" : {
     "@id" : "_513851584E39002"
   }
}, {
   "@id" : "_513851584E39003",
   "@type" : "up:Citation_Statement",
   "up:scope" : "NUCLEOTIDE SEQUENCE",
   "up:context" : {
     "@id" : "_513851584E39004",
     "@type" : "up:Strain",
     "rdfs:label" : "Cox"
   },
   "up:attribution" : {
     "@id" : "_513851584E39006"
   }
}, {
   "@id" : "_513851584E39005",
   "up:attribution" : {
     "@id" : "_513851584E39006"
   }
}, {
   "@id" : "_513851584E39007",
   "@type" : "up:Citation_Statement",
   "up:scope" : "X-RAY CRYSTALLOGRAPHY (2.25 ANGSTROMS) OF 1749-2209 IN 
COMPLEX WITH ATP; CTP; GTP; MANGANESE AND SODIUM",
   "up:attribution" : [ {
     "@id" : "_513851584E3900D"
   }, {
     "@id" : "_513851584E3900C"
   }, {
     "@id" : "_513851584E3900B"
   }, {
     "@id" : "_513851584E3900A"
   }, {
     "@id" : "_513851584E39009"
   }, {
     "@id" : "_513851584E39008"
   } ]
}, {
   "@id" : "_513851584E3900E",
   "@type" : "up:Citation_Statement",
   "up:scope" : "X-RAY CRYSTALLOGRAPHY (3.00 ANGSTROMS) OF 1749-2209",
   "up:attribution" : {
     "@id" : "_513851584E3900F"
   }
}, {
   "@id" : "_513851584E390010",
   "@type" : "up:Structure_Mapping_Statement",
   "up:chain" : "A=1749-2209"
}, {
   "@id" : "_513851584E390011",
   "@type" : "up:Structure_Mapping_Statement",
   "up:chain" : "A=1749-2209"
}, {
   "@id" : "_513851584E390012",
   "@type" : "up:Structure_Mapping_Statement",
   "up:chain" : "A=1749-2209"
}, {
   "@id" : "_513851584E390013",
   "@type" : "up:Structure_Mapping_Statement",
   "up:chain" : "A=1749-2209"
}, {
   "@id" : "_513851584E390014",
   "@type" : "up:Structure_Mapping_Statement",
   "up:chain" : "A=1749-2209"
}, {
   "@id" : "_513851584E390015",
   "@type" : "up:Structure_Mapping_Statement",
   "up:chain" : "A=1749-2209"
}, {
   "@id" : "_513851584E390016",
   "@type" : "up:Structure_Mapping_Statement",
   "up:chain" : "A=1749-2209"
}, {
   "@id" : "_513851584E390017",
   "@type" : "up:Domain_Assignment_Statement",
   "up:hits" : "2"
}, {
   "@id" : "_513851584E390018",
   "@type" : "up:Domain_Assignment_Statement",
   "up:hits" : "1"
}, {
   "@id" : "_513851584E390019",
   "@type" : "up:Domain_Assignment_Statement",
   "up:hits" : "1"
}, {
   "@id" : "_513851584E39001A",
   "@type" : "up:Domain_Assignment_Statement",
   "up:hits" : "1"
}, {
   "@id" : "_513851584E39001B",
   "@type" : "up:Domain_Assignment_Statement",
   "up:hits" : "1"
}, {
   "@id" : "_513851584E39001C",
   "@type" : "up:Domain_Assignment_Statement",
   "up:hits" : "1"
}, {
   "@id" : "_513851584E39001D",
   "@type" : "up:Domain_Assignment_Statement",
   "up:hits" : "1"
}, {
   "@id" : "_513851584E39001E",
   "@type" : "up:Domain_Assignment_Statement",
   "up:hits" : "3"
}, {
   "@id" : "_513851584E39001F",
   "@type" : "up:Domain_Assignment_Statement",
   "up:hits" : "1"
}, {
   "@id" : "_513851584E390020",
   "@type" : "up:Domain_Assignment_Statement",
   "up:hits" : "1"
}, {
   "@id" : "_513851584E390021",
   "@type" : "up:Domain_Assignment_Statement",
   "up:hits" : "1"
}, {
   "@id" : "_513851584E390022",
   "@type" : "up:Domain_Assignment_Statement",
   "up:hits" : "1"
}, {
   "@id" : "_513851584E390023",
   "@type" : "up:Domain_Assignment_Statement",
   "up:hits" : "2"
}, {
   "@id" : "_513851584E390024",
   "@type" : "up:Domain_Assignment_Statement",
   "up:hits" : "1"
}, {
   "@id" : "_513851584E390025",
   "@type" : "up:Domain_Assignment_Statement",
   "up:hits" : "1"
}, {
   "@id" : "_513851584E390026",
   "@type" : "up:Domain_Assignment_Statement",
   "up:hits" : "1"
}, {
   "@id" : "_513851584E390027",
   "@type" : "up:Domain_Assignment_Statement",
   "up:hits" : "1"
}, {
   "@id" : "_513851584E390029",
   "up:attribution" : {
     "@id" : "_513851584E39006"
   }
}, {
   "@id" : "_513851584E39002A",
   "up:attribution" : {
     "@id" : "_513851584E39006"
   }
}, {
   "@id" : "_513851584E39002C",
   "up:attribution" : {
     "@id" : "_513851584E39002D"
   }
}, {
   "@id" : "_513851584E39002F",
   "up:attribution" : {
     "@id" : "_513851584E390030"
   }
}, {
   "@id" : "_513851584E390032",
   "up:attribution" : {
     "@id" : "_513851584E390033"
   }
}, {
   "@id" : "_513851584E390036",
   "up:status" : {
     "@id" : "http://purl.uniprot.org/core/By_Similarity"
   },
   "up:attribution" : {
     "@id" : "_513851584E390037"
   }
}, {
   "@id" : "_513851584E390039",
   "up:attribution" : {
     "@id" : "_513851584E39003A"
   }
}, {
   "@id" : "_513851584E39003C",
   "up:attribution" : {
     "@id" : "_513851584E39003D"
   }
}, {
   "@id" : "_513851584E39003F",
   "up:attribution" : {
     "@id" : "_513851584E39003D"
   }
}, {
   "@id" : "_513851584E390040",
   "up:attribution" : {
     "@id" : "_513851584E39006"
   }
}, {
   "@id" : "_513851584E390042",
   "up:attribution" : {
     "@id" : "_513851584E39006"
   }
}, {
   "@id" : "_513851584E390044",
   "up:attribution" : {
     "@id" : "_513851584E39006"
   }
}, {
   "@id" : "_513851584E390046",
   "up:attribution" : {
     "@id" : "_513851584E39006"
   }
}, {
   "@id" : "_513851584E390048",
   "up:attribution" : {
     "@id" : "_513851584E39006"
   }
}, {
   "@id" : "_513851584E39004A",
   "up:attribution" : {
     "@id" : "_513851584E39006"
   }
}, {
   "@id" : "_513851584E39004C",
   "up:attribution" : {
     "@id" : "_513851584E39006"
   }
}, {
   "@id" : "_513851584E39004E",
   "up:attribution" : {
     "@id" : "_513851584E39006"
   }
}, {
   "@id" : "_513851584E390050",
   "up:attribution" : {
     "@id" : "_513851584E39006"
   }
}, {
   "@id" : "_513851584E390052",
   "up:attribution" : {
     "@id" : "_513851584E39006"
   }
}, {
   "@id" : "_513851584E390054",
   "up:attribution" : {
     "@id" : "_513851584E39006"
   }
}, {
   "@id" : "_513851584E390059",
   "up:attribution" : [ {
     "@id" : "_513851584E3900B"
   }, {
     "@id" : "_513851584E3900A"
   } ]
}, {
   "@id" : "_513851584E39005C",
   "up:attribution" : {
     "@id" : "_513851584E39008"
   }
}, {
   "@id" : "_513851584E39005F",
   "up:attribution" : [ {
     "@id" : "_513851584E3900B"
   }, {
     "@id" : "_513851584E3900A"
   } ]
}, {
   "@id" : "_513851584E390062",
   "up:attribution" : {
     "@id" : "_513851584E39008"
   }
}, {
   "@id" : "_513851584E390067",
   "up:attribution" : {
     "@id" : "_513851584E39008"
   }
}, {
   "@id" : "_513851584E39006A",
   "up:attribution" : {
     "@id" : "_513851584E39008"
   }
}, {
   "@id" : "_513851584E39006D",
   "up:attribution" : [ {
     "@id" : "_513851584E3900D"
   }, {
     "@id" : "_513851584E3900C"
   }, {
     "@id" : "_513851584E3900B"
   }, {
     "@id" : "_513851584E3900A"
   }, {
     "@id" : "_513851584E39009"
   }, {
     "@id" : "_513851584E39008"
   } ]
}, {
   "@id" : "_513851584E390070",
   "up:attribution" : [ {
     "@id" : "_513851584E3900D"
   }, {
     "@id" : "_513851584E3900C"
   }, {
     "@id" : "_513851584E3900A"
   }, {
     "@id" : "_513851584E39008"
   } ]
}, {
   "@id" : "_513851584E390073",
   "up:attribution" : [ {
     "@id" : "_513851584E3900D"
   }, {
     "@id" : "_513851584E3900C"
   }, {
     "@id" : "_513851584E3900B"
   }, {
     "@id" : "_513851584E3900A"
   }, {
     "@id" : "_513851584E39009"
   }, {
     "@id" : "_513851584E39008"
   } ]
}, {
   "@id" : "_513851584E390076",
   "up:attribution" : [ {
     "@id" : "_513851584E3900D"
   }, {
     "@id" : "_513851584E3900C"
   }, {
     "@id" : "_513851584E3900B"
   }, {
     "@id" : "_513851584E3900A"
   }, {
     "@id" : "_513851584E39009"
   }, {
     "@id" : "_513851584E39008"
   } ]
}, {
   "@id" : "_513851584E390079",
   "up:attribution" : [ {
     "@id" : "_513851584E3900D"
   }, {
     "@id" : "_513851584E3900C"
   }, {
     "@id" : "_513851584E3900B"
   }, {
     "@id" : "_513851584E3900A"
   }, {
     "@id" : "_513851584E39009"
   }, {
     "@id" : "_513851584E39008"
   } ]
}, {
   "@id" : "_513851584E39007C",
   "up:attribution" : {
     "@id" : "_513851584E3900D"
   }
}, {
   "@id" : "_513851584E39007F",
   "up:attribution" : {
     "@id" : "_513851584E39008"
   }
}, {
   "@id" : "_513851584E390084",
   "up:attribution" : [ {
     "@id" : "_513851584E3900B"
   }, {
     "@id" : "_513851584E3900A"
   } ]
}, {
   "@id" : "_513851584E39008B",
   "up:attribution" : [ {
     "@id" : "_513851584E3900B"
   }, {
     "@id" : "_513851584E3900A"
   } ]
}, {
   "@id" : "_513851584E39008E",
   "up:attribution" : {
     "@id" : "_513851584E39008"
   }
}, {
   "@id" : "_513851584E390090",
   "up:attribution" : [ {
     "@id" : "_513851584E3900D"
   }, {
     "@id" : "_513851584E3900C"
   }, {
     "@id" : "_513851584E3900B"
   }, {
     "@id" : "_513851584E3900A"
   }, {
     "@id" : "_513851584E39009"
   }, {
     "@id" : "_513851584E39008"
   }, {
     "@id" : "_513851584E3900F"
   } ]
}, {
   "@id" : "_513851584E390091",
   "up:attribution" : {
     "@id" : "_513851584E390092"
   }
}, {
   "@id" : "_513851584E390093",
   "up:attribution" : {
     "@id" : "_513851584E39008"
   }
}, {
   "@id" : "_513851584E390094",
   "up:attribution" : {
     "@id" : "_513851584E390095"
   }
}, {
   "@id" : "_513851584E390096",
   "up:attribution" : {
     "@id" : "_513851584E390097"
   }
}, {
   "@id" : "_513851584E390098",
   "up:attribution" : {
     "@id" : "_513851584E390099"
   }
}, {
   "@id" : "_513851584E39009A",
   "up:attribution" : {
     "@id" : "_513851584E39009B"
   }
}, {
   "@id" : "_513851584E39009C",
   "up:attribution" : [ {
     "@id" : "_513851584E3900D"
   }, {
     "@id" : "_513851584E3900B"
   }, {
     "@id" : "_513851584E39008"
   } ]
}, {
   "@id" : "_513851584E39009D",
   "up:attribution" : [ {
     "@id" : "_513851584E3900D"
   }, {
     "@id" : "_513851584E3900C"
   }, {
     "@id" : "_513851584E3900B"
   }, {
     "@id" : "_513851584E3900A"
   }, {
     "@id" : "_513851584E39009"
   }, {
     "@id" : "_513851584E39008"
   } ]
}, {
   "@id" : "_513851584E39009E",
   "up:attribution" : {
     "@id" : "_513851584E39009F"
   }
}, {
   "@id" : "_513851584E3900A0",
   "up:attribution" : {
     "@id" : "_513851584E3900A1"
   }
}, {
   "@id" : "_513851584E3900A2",
   "up:attribution" : {
     "@id" : "_513851584E3900A3"
   }
}, {
   "@id" : "_513851584E3900A4",
   "up:attribution" : [ {
     "@id" : "_513851584E3900D"
   }, {
     "@id" : "_513851584E3900C"
   }, {
     "@id" : "_513851584E3900B"
   }, {
     "@id" : "_513851584E3900A"
   }, {
     "@id" : "_513851584E39009"
   }, {
     "@id" : "_513851584E39008"
   } ]
}, {
   "@id" : "_513851584E3900A5",
   "up:attribution" : {
     "@id" : "_513851584E3900A6"
   }
}, {
   "@id" : "_513851584E3900A7",
   "up:attribution" : {
     "@id" : "_513851584E3900A8"
   }
}, {
   "@id" : "_513851584E3900A9",
   "up:attribution" : {
     "@id" : "_513851584E3900AA"
   }
}, {
   "@id" : "_513851584E3900AB",
   "up:attribution" : {
     "@id" : "_513851584E3900AC"
   }
}, {
   "@id" : "_513851584E3900AD",
   "up:attribution" : {
     "@id" : "_513851584E3900AE"
   }
}, {
   "@id" : "_513851584E3900AF",
   "up:attribution" : {
     "@id" : "_513851584E3900B0"
   }
}, {
   "@id" : "_513851584E3900B1",
   "up:attribution" : {
     "@id" : "_513851584E3900B2"
   }
}, {
   "@id" : "_513851584E3900B3",
   "up:attribution" : {
     "@id" : "_513851584E3900B4"
   }
}, {
   "@id" : "_513851584E3900B5",
   "up:attribution" : {
     "@id" : "_513851584E3900B6"
   }
}, {
   "@id" : "_513851584E3900B7",
   "up:attribution" : {
     "@id" : "_513851584E3900B8"
   }
}, {
   "@id" : "_513851584E3900B9",
   "up:attribution" : {
     "@id" : "_513851584E3900BA"
   }
}, {
   "@id" : "_513851584E3900BB",
   "up:attribution" : {
     "@id" : "_513851584E3900BC"
   }
}, {
   "@id" : "_513851584E3900BD",
   "up:attribution" : {
     "@id" : "_513851584E3900BE"
   }
}, {
   "@id" : "_513851584E3900BF",
   "up:attribution" : {
     "@id" : "_513851584E3900C0"
   }
}, {
   "@id" : "_513851584E3900C1",
   "up:attribution" : {
     "@id" : "_513851584E3900C2"
   }
}, {
   "@id" : "_513851584E3900C3",
   "up:attribution" : {
     "@id" : "_513851584E3900C4"
   }
}, {
   "@id" : "_513851584E3900C5",
   "up:attribution" : {
     "@id" : "_513851584E3900C6"
   }
}, {
   "@id" : "_513851584E3900C7",
   "up:attribution" : {
     "@id" : "_513851584E3900C8"
   }
}, {
   "@id" : "_513851584E3900C9",
   "up:attribution" : {
     "@id" : "_513851584E3900CA"
   }
}, {
   "@id" : "_513851584E3900CB",
   "up:attribution" : {
     "@id" : "_513851584E3900CC"
   }
}, {
   "@id" : "_513851584E3900CD",
   "up:attribution" : {
     "@id" : "_513851584E3900CE"
   }
}, {
   "@id" : "_513851584E3900CF",
   "up:attribution" : {
     "@id" : "_513851584E3900D0"
   }
}, {
   "@id" : "_513851584E39001",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "up:citation",
   "rdf:object" : "http://purl.uniprot.org/citations/2555183"
}, {
   "@id" : "_513851584E39003",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "up:citation",
   "rdf:object" : "http://purl.uniprot.org/citations/11991962"
}, {
   "@id" : "_513851584E39005",
   "@type" : "rdf:Statement",
   "rdf:subject" : "_513851584E39003",
   "rdf:predicate" : "up:context",
   "rdf:object" : "_513851584E39004"
}, {
   "@id" : "_513851584E39007",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "up:citation",
   "rdf:object" : "http://purl.uniprot.org/citations/17223130"
}, {
   "@id" : "_513851584E3900E",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "up:citation",
   "rdf:object" : "http://purl.uniprot.org/citations/17251299"
}, {
   "@id" : "_513851584E390010",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "rdfs:seeAlso",
   "rdf:object" : "http://rdf.wwpdb.org/pdb/2IJF"
}, {
   "@id" : "_513851584E390011",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "rdfs:seeAlso",
   "rdf:object" : "http://rdf.wwpdb.org/pdb/2ILY"
}, {
   "@id" : "_513851584E390012",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "rdfs:seeAlso",
   "rdf:object" : "http://rdf.wwpdb.org/pdb/2ILZ"
}, {
   "@id" : "_513851584E390013",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "rdfs:seeAlso",
   "rdf:object" : "http://rdf.wwpdb.org/pdb/2IM0"
}, {
   "@id" : "_513851584E390014",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "rdfs:seeAlso",
   "rdf:object" : "http://rdf.wwpdb.org/pdb/2IM1"
}, {
   "@id" : "_513851584E390015",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "rdfs:seeAlso",
   "rdf:object" : "http://rdf.wwpdb.org/pdb/2IM2"
}, {
   "@id" : "_513851584E390016",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "rdfs:seeAlso",
   "rdf:object" : "http://rdf.wwpdb.org/pdb/2IM3"
}, {
   "@id" : "_513851584E390017",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "rdfs:seeAlso",
   "rdf:object" : "http://purl.uniprot.org/gene3d/4.10.80.10"
}, {
   "@id" : "_513851584E390018",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "rdfs:seeAlso",
   "rdf:object" : "http://purl.uniprot.org/pfam/PF08727"
}, {
   "@id" : "_513851584E390019",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "rdfs:seeAlso",
   "rdf:object" : "http://purl.uniprot.org/pfam/PF00548"
}, {
   "@id" : "_513851584E39001A",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "rdfs:seeAlso",
   "rdf:object" : "http://purl.uniprot.org/pfam/PF02226"
}, {
   "@id" : "_513851584E39001B",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "rdfs:seeAlso",
   "rdf:object" : "http://purl.uniprot.org/pfam/PF00947"
}, {
   "@id" : "_513851584E39001C",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "rdfs:seeAlso",
   "rdf:object" : "http://purl.uniprot.org/pfam/PF01552"
}, {
   "@id" : "_513851584E39001D",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "rdfs:seeAlso",
   "rdf:object" : "http://purl.uniprot.org/pfam/PF00680"
}, {
   "@id" : "_513851584E39001E",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "rdfs:seeAlso",
   "rdf:object" : "http://purl.uniprot.org/pfam/PF00073"
}, {
   "@id" : "_513851584E39001F",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "rdfs:seeAlso",
   "rdf:object" : "http://purl.uniprot.org/pfam/PF00910"
}, {
   "@id" : "_513851584E390020",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "rdfs:seeAlso",
   "rdf:object" : "http://purl.uniprot.org/prodom/PD001306"
}, {
   "@id" : "_513851584E390021",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "rdfs:seeAlso",
   "rdf:object" : "http://purl.uniprot.org/prodom/PD649346"
}, {
   "@id" : "_513851584E390022",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "rdfs:seeAlso",
   "rdf:object" : "http://purl.uniprot.org/smart/SM00382"
}, {
   "@id" : "_513851584E390023",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "rdfs:seeAlso",
   "rdf:object" : "http://purl.uniprot.org/supfam/SSF50494"
}, {
   "@id" : "_513851584E390024",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "rdfs:seeAlso",
   "rdf:object" : "http://purl.uniprot.org/supfam/SSF52540"
}, {
   "@id" : "_513851584E390025",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "rdfs:seeAlso",
   "rdf:object" : "http://purl.uniprot.org/supfam/SSF89043"
}, {
   "@id" : "_513851584E390026",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "rdfs:seeAlso",
   "rdf:object" : "http://purl.uniprot.org/prosite/PS50507"
}, {
   "@id" : "_513851584E390027",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "rdfs:seeAlso",
   "rdf:object" : "http://purl.uniprot.org/prosite/PS51218"
}, {
   "@id" : "_513851584E390029",
   "@type" : "rdf:Statement",
   "rdf:subject" : 
"http://purl.uniprot.org/SHA-384/C2507C631F3F9C2E2C3B2245EEC4EFC6CA97E92BBDE92F4439365244FE7508833CADDDAC655DD0E038DF59E3E9BD7EF1",
   "rdf:predicate" : "up:fullName",
   "rdf:object" : "Polyprotein"
}, {
   "@id" : "_513851584E39002A",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "up:organism",
   "rdf:object" : "http://purl.uniprot.org/taxonomy/12080"
}, {
   "@id" : "_513851584E39002C",
   "@type" : "rdf:Statement",
   "rdf:subject" : 
"http://purl.uniprot.org/SHA-384/27D54F8B946A5C77E37F119158C5C6F6B678D232332CB9595ECAFBA2DDEC121986C20B75CDDD67F8B5246058CDA6B5BF",
   "rdf:predicate" : "rdfs:comment",
   "rdf:object" : "NTP + H(2)O = NDP + phosphate."
}, {
   "@id" : "_513851584E39002F",
   "@type" : "rdf:Statement",
   "rdf:subject" : 
"http://purl.uniprot.org/SHA-384/ED1A552EC576DB71D62330DD4294914C3C0C03D15C9F861B3B2F2DB98CF5D0E48D20B08E30F7C2615371B5730E2A4D8A",
   "rdf:predicate" : "rdfs:comment",
   "rdf:object" : "Nucleoside triphosphate + RNA(n) = diphosphate + 
RNA(n+1)."
}, {
   "@id" : "_513851584E390032",
   "@type" : "rdf:Statement",
   "rdf:subject" : 
"http://purl.uniprot.org/SHA-384/D705F5D18AC04BE7B63EBF7397A172AFFAC9F0E6A5C42CE272CA4C2FDDD1B6CC391ACB5783E693EBE7F62FD658E566B9",
   "rdf:predicate" : "rdfs:comment",
   "rdf:object" : "Selective cleavage of Gln-|-Gly bond in the 
poliovirus polyprotein. In other picornavirus reactions Glu may be 
substituted for Gln, and Ser or Thr for Gly."
}, {
   "@id" : "_513851584E390036",
   "@type" : "rdf:Statement",
   "rdf:subject" : 
"http://purl.uniprot.org/SHA-384/059A9B54AF2333F3F57498DC0938C88BB6E601D4569749E771BE37E28D78111E2DC9320B7AFCDD93047695D576AC43C7",
   "rdf:predicate" : "up:orientation",
   "rdf:object" : "http://purl.uniprot.org/locations/9910"
}, {
   "@id" : "_513851584E390039",
   "@type" : "rdf:Statement",
   "rdf:subject" : 
"http://purl.uniprot.org/SHA-384/4D1DC3C2F95A29E4A2EBAD93DCEB3598789B7E8CC03DD46CF52175032E7A59E3FBB3D186117D231643AB19F56C117FFD",
   "rdf:predicate" : "rdfs:comment",
   "rdf:object" : "Contains RdRp catalytic domain."
}, {
   "@id" : "_513851584E39003C",
   "@type" : "rdf:Statement",
   "rdf:subject" : 
"http://purl.uniprot.org/SHA-384/22978A1CE62271011D9DAEDC950CCBA6DE32B58E1A57F8BF035EF394AF7C3EF71D22DB6BE303E82AAA6E628C14E92B4A",
   "rdf:predicate" : "rdfs:comment",
   "rdf:object" : "Contains SF3 helicase domain."
}, {
   "@id" : "_513851584E39003F",
   "@type" : "rdf:Statement",
   "rdf:subject" : 
"http://purl.uniprot.org/SHA-384/7456B29DA999AB53E79ADA1849426F70FC4437C9ADF780E388BB7D780CCF84B552C6D20620A6390F7F806B5BE02E9F10",
   "rdf:predicate" : "rdfs:comment",
   "rdf:object" : "Contains SFhelicase domain."
}, {
   "@id" : "_513851584E390040",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "up:annotation",
   "rdf:object" : "http://purl.uniprot.org/annotation/PRO_5000068238"
}, {
   "@id" : "_513851584E390042",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "up:annotation",
   "rdf:object" : "http://purl.uniprot.org/annotation/PRO_5000068239"
}, {
   "@id" : "_513851584E390044",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "up:annotation",
   "rdf:object" : "http://purl.uniprot.org/annotation/PRO_5000068240"
}, {
   "@id" : "_513851584E390046",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "up:annotation",
   "rdf:object" : "http://purl.uniprot.org/annotation/PRO_5000068241"
}, {
   "@id" : "_513851584E390048",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "up:annotation",
   "rdf:object" : "http://purl.uniprot.org/annotation/PRO_5000068242"
}, {
   "@id" : "_513851584E39004A",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "up:annotation",
   "rdf:object" : "http://purl.uniprot.org/annotation/PRO_5000068243"
}, {
   "@id" : "_513851584E39004C",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "up:annotation",
   "rdf:object" : "http://purl.uniprot.org/annotation/PRO_5000068244"
}, {
   "@id" : "_513851584E39004E",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "up:annotation",
   "rdf:object" : "http://purl.uniprot.org/annotation/PRO_5000068245"
}, {
   "@id" : "_513851584E390050",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "up:annotation",
   "rdf:object" : "http://purl.uniprot.org/annotation/PRO_5000068246"
}, {
   "@id" : "_513851584E390052",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "up:annotation",
   "rdf:object" : "http://purl.uniprot.org/annotation/PRO_5000068247"
}, {
   "@id" : "_513851584E390054",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "up:annotation",
   "rdf:object" : "http://purl.uniprot.org/annotation/PRO_5000068248"
}, {
   "@id" : "_513851584E390059",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "up:annotation",
   "rdf:object" : 
"http://purl.uniprot.org/SHA-384/A6EDCAD1A6CF7661B0FB797D75134C03941160AA53C5B9CDCF0DD1955ECB5675D04F75D2C929C9A0B51044B319A39DC5"
}, {
   "@id" : "_513851584E39005C",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "up:annotation",
   "rdf:object" : 
"http://purl.uniprot.org/SHA-384/C7D97F4D1BE0CA8FEA40647D5A35E968C77C51EB95E79B37F38B2E31159D13F55E4E460ADB7D7C12B73AABE607632937"
}, {
   "@id" : "_513851584E39005F",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "up:annotation",
   "rdf:object" : 
"http://purl.uniprot.org/SHA-384/D0124137CDF5FC95FD835B0851D5CD5C6147F2EFB96F8F3A58C837C94345029C1ABE153EA7D02ACFD85DB55987D83041"
}, {
   "@id" : "_513851584E390062",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "up:annotation",
   "rdf:object" : 
"http://purl.uniprot.org/SHA-384/51527B1C8771BD6E1D042B85016EE7CBA556DD806AB80DCD08A83FE13AB8F7695F17725B97CC29D11F871C5B7F4C6505"
}, {
   "@id" : "_513851584E390067",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "up:annotation",
   "rdf:object" : 
"http://purl.uniprot.org/SHA-384/51CB91E6A7D642C426B611C86208649C5C8AD97AA0CC0F70779D81D8AEF06B599FC79C92DF82B6B0A968E48D84574CBC"
}, {
   "@id" : "_513851584E39006A",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "up:annotation",
   "rdf:object" : 
"http://purl.uniprot.org/SHA-384/D2C62626E4DD2CBF279BA52A7C34964B309583597829CC282EC0F06257CB011B1B987A55FC5F67D8A81C1F4C5C77DB89"
}, {
   "@id" : "_513851584E39006D",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "up:annotation",
   "rdf:object" : 
"http://purl.uniprot.org/SHA-384/E6E089BB7B738695CFD2344B5FD37F93DC27A4D7C9C347743F41DD185C2F0AF9B89B5AB0C1589F56655E71CB1CC15A77"
}, {
   "@id" : "_513851584E390070",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "up:annotation",
   "rdf:object" : 
"http://purl.uniprot.org/SHA-384/C5CFF5641E51B4EBF0BE6CAB147DBC7AA5DBD989E279002553BE4BACCC286DD57ADC25093229D6A26FE0E3400D311661"
}, {
   "@id" : "_513851584E390073",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "up:annotation",
   "rdf:object" : 
"http://purl.uniprot.org/SHA-384/EF0DF6382D46D140E6CC3CC7812772560F8672AE727CF81CF1AEC48D122CDF1F421ACA7A55B42F1DCC9099AA0AA5FB2B"
}, {
   "@id" : "_513851584E390076",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "up:annotation",
   "rdf:object" : 
"http://purl.uniprot.org/SHA-384/963335128AC4894E3B08D731E2D356B65A235B6E38682871FAE9EF6F3430762D523A40DFE22626226CA780821E75BEB6"
}, {
   "@id" : "_513851584E390079",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "up:annotation",
   "rdf:object" : 
"http://purl.uniprot.org/SHA-384/4621E5B0FB9C13CD7E6ABC6B73E7E506ACBE3CCE439B0D8FCEB36A49F5E8078FFE1543031471A684E233E8C2725AAE50"
}, {
   "@id" : "_513851584E39007C",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "up:annotation",
   "rdf:object" : 
"http://purl.uniprot.org/SHA-384/4950E69B2813DD130F757167FDB90CB61BD9C2CB964108A43407D8D6C407630A90A7F84D2D97177937E61AEC7495B832"
}, {
   "@id" : "_513851584E39007F",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "up:annotation",
   "rdf:object" : 
"http://purl.uniprot.org/SHA-384/DE1F03A74D4F03E30E1676F3B8E209751765BBB275497C3ECD00EA8D41E4EF453EF008482DEC34A2C12630D1F5C149F6"
}, {
   "@id" : "_513851584E390084",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "up:annotation",
   "rdf:object" : 
"http://purl.uniprot.org/SHA-384/20DB84DF8ACB37740528D59BE80D073220E7F6EFA97BC6975E49ED5FF318D5BE87FB77C14784B38EF4DBA043BD5204EA"
}, {
   "@id" : "_513851584E39008B",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "up:annotation",
   "rdf:object" : 
"http://purl.uniprot.org/SHA-384/B446A6108285C8C65F72D02282F79D1BBA827CB8FD6DDD7EC9B3D25D57AC4E0128F26B39AA562A79FDC463F8AD3AED15"
}, {
   "@id" : "_513851584E39008E",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "up:annotation",
   "rdf:object" : 
"http://purl.uniprot.org/SHA-384/282660931265EC96C28CE7E47418431C2D5DFC23DDF7E92CF75A4289FF6692B3873F007D1F1C5AE3522E61C90CF999EC"
}, {
   "@id" : "_513851584E390090",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "up:classifiedWith",
   "rdf:object" : "http://purl.uniprot.org/keywords/2"
}, {
   "@id" : "_513851584E390091",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "up:classifiedWith",
   "rdf:object" : "http://purl.uniprot.org/keywords/167"
}, {
   "@id" : "_513851584E390093",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "up:classifiedWith",
   "rdf:object" : "http://purl.uniprot.org/keywords/342"
}, {
   "@id" : "_513851584E390094",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "up:classifiedWith",
   "rdf:object" : "http://purl.uniprot.org/keywords/347"
}, {
   "@id" : "_513851584E390096",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "up:classifiedWith",
   "rdf:object" : "http://purl.uniprot.org/keywords/1035"
}, {
   "@id" : "_513851584E390098",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "up:classifiedWith",
   "rdf:object" : "http://purl.uniprot.org/keywords/1036"
}, {
   "@id" : "_513851584E39009A",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "up:classifiedWith",
   "rdf:object" : "http://purl.uniprot.org/keywords/1043"
}, {
   "@id" : "_513851584E39009C",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "up:classifiedWith",
   "rdf:object" : "http://purl.uniprot.org/keywords/464"
}, {
   "@id" : "_513851584E39009D",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "up:classifiedWith",
   "rdf:object" : "http://purl.uniprot.org/keywords/479"
}, {
   "@id" : "_513851584E39009E",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "up:classifiedWith",
   "rdf:object" : "http://purl.uniprot.org/keywords/597"
}, {
   "@id" : "_513851584E3900A0",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "up:classifiedWith",
   "rdf:object" : "http://purl.uniprot.org/keywords/694"
}, {
   "@id" : "_513851584E3900A2",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "up:classifiedWith",
   "rdf:object" : "http://purl.uniprot.org/keywords/696"
}, {
   "@id" : "_513851584E3900A4",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "up:classifiedWith",
   "rdf:object" : "http://purl.uniprot.org/keywords/915"
}, {
   "@id" : "_513851584E3900A5",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "up:classifiedWith",
   "rdf:object" : "http://purl.uniprot.org/keywords/788"
}, {
   "@id" : "_513851584E3900A7",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "up:classifiedWith",
   "rdf:object" : "http://purl.uniprot.org/keywords/1161"
}, {
   "@id" : "_513851584E3900A9",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "up:classifiedWith",
   "rdf:object" : "http://purl.uniprot.org/keywords/1182"
}, {
   "@id" : "_513851584E3900AB",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "up:classifiedWith",
   "rdf:object" : "http://purl.uniprot.org/keywords/693"
}, {
   "@id" : "_513851584E3900AD",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "up:classifiedWith",
   "rdf:object" : "http://purl.uniprot.org/go/0044162"
}, {
   "@id" : "_513851584E3900AF",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "up:classifiedWith",
   "rdf:object" : "http://purl.uniprot.org/go/0016020"
}, {
   "@id" : "_513851584E3900B1",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "up:classifiedWith",
   "rdf:object" : "http://purl.uniprot.org/go/0019028"
}, {
   "@id" : "_513851584E3900B3",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "up:classifiedWith",
   "rdf:object" : "http://purl.uniprot.org/go/0005524"
}, {
   "@id" : "_513851584E3900B5",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "up:classifiedWith",
   "rdf:object" : "http://purl.uniprot.org/go/0004197"
}, {
   "@id" : "_513851584E3900B7",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "up:classifiedWith",
   "rdf:object" : "http://purl.uniprot.org/go/0003723"
}, {
   "@id" : "_513851584E3900B9",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "up:classifiedWith",
   "rdf:object" : "http://purl.uniprot.org/go/0003724"
}, {
   "@id" : "_513851584E3900BB",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "up:classifiedWith",
   "rdf:object" : "http://purl.uniprot.org/go/0003968"
}, {
   "@id" : "_513851584E3900BD",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "up:classifiedWith",
   "rdf:object" : "http://purl.uniprot.org/go/0005198"
}, {
   "@id" : "_513851584E3900BF",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "up:classifiedWith",
   "rdf:object" : "http://purl.uniprot.org/go/0006811"
}, {
   "@id" : "_513851584E3900C1",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "up:classifiedWith",
   "rdf:object" : "http://purl.uniprot.org/go/0019048"
}, {
   "@id" : "_513851584E3900C3",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "up:classifiedWith",
   "rdf:object" : "http://purl.uniprot.org/go/0006508"
}, {
   "@id" : "_513851584E3900C5",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "up:classifiedWith",
   "rdf:object" : "http://purl.uniprot.org/go/0018144"
}, {
   "@id" : "_513851584E3900C7",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "up:classifiedWith",
   "rdf:object" : "http://purl.uniprot.org/go/0006351"
}, {
   "@id" : "_513851584E3900C9",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "up:classifiedWith",
   "rdf:object" : "http://purl.uniprot.org/go/0001172"
}, {
   "@id" : "_513851584E3900CB",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "up:classifiedWith",
   "rdf:object" : "http://purl.uniprot.org/go/0019062"
}, {
   "@id" : "_513851584E3900CD",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "up:classifiedWith",
   "rdf:object" : "http://purl.uniprot.org/go/0046718"
}, {
   "@id" : "_513851584E3900CF",
   "@type" : "rdf:Statement",
   "rdf:subject" : "http://purl.uniprot.org/uniprot/Q8QXN9",
   "rdf:predicate" : "up:classifiedWith",
   "rdf:object" : "http://purl.uniprot.org/go/0019079"
} ]
}

Received on Thursday, 20 March 2014 14:21:16 UTC